DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and pde7a

DIOPT Version :9

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:XP_005162725.1 Gene:pde7a / 100151215 ZFINID:ZDB-GENE-031222-10 Length:516 Species:Danio rerio


Alignment Length:451 Identity:109/451 - (24%)
Similarity:191/451 - (42%) Gaps:75/451 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 RPSVSELSSSTLAQIAQFVATTGQTV--------NICDVIEW-----VRDHNQIRAEDEIDSTQA 565
            |.::|..||...|...:.:|.|.:|:        ..|.:.:.     ||..:|:..|.|...:..
Zfish    48 RGAISYDSSDQTALYIRMLAVTNKTIKSSFVFTPGACVIFKQLFSRDVRVRSQVGFEPERRGSHP 112

  Fly   566 ILCMPIMNAQKKVIGVAQLINKANGVPFTDSDASIFEAFAIFCGLGIHNTQMYENACKLMAKQKV 630
            .|                      |:.|..                :|:..  |:|..:.|::..
Zfish   113 YL----------------------GIDFRT----------------LHSRA--ESAGSIPARRIR 137

  Fly   631 ALECLSYHATASQ--------DQTEKLTQDVIAEA----ESYNLYSFTFTDFELVDDDTCRAVL- 682
            .|.....|..:|:        :....|.:|...:|    |....::|....|:.:.:......| 
Zfish   138 RLFSFQRHLLSSRLLRGAPHLNPLHILDEDYCGQAKCMLEKVGSWNFDIFLFDRLTNGNSLVFLT 202

  Fly   683 -RMFMQCNLVSQFQIPYDVLCRWVLSVRKNYRPVK-YHNWRHALNVAQTMFAMLKTGKMERFMTD 745
             .:..|..|:..||:....:.|:::.|:::|.... |||..||.:|.|.|...|:..|:.:.:|.
Zfish   203 FHLLSQYGLIELFQLDMVKVRRFLVLVQEDYHNQNPYHNAVHAADVTQAMHCYLREPKLAQSLTS 267

  Fly   746 LEILGLLVACLCHDLDHRGTNNAFQTKTESPLAILY-TTSTMEHHHFDQCVMILNSEGNNIFQAL 809
            .:||..|:|...|||||.|.|..|..||...||.|| .||.:|:||:...|.:|..  ..:|..|
Zfish   268 FDILLGLLAAATHDLDHPGVNQPFLIKTNHYLAALYRNTSVLENHHWRSAVGLLRE--TELFSHL 330

  Fly   810 SPEDYRSVMKTVESAILSTDLAMYFKKRNAFLELVENGEFDWQGEEKKDLLCGMMMTACDVSAIA 874
            ..||..|:.:.:.|.||:||::...:..:.|...::..:.:......:..:..|.:...|:....
Zfish   331 PAEDSLSIERQLGSLILATDISRQNEYLSRFRTHLDENDLNLGNASHRHFVLQMALKCADICNPC 395

  Fly   875 KPWEVQHKVAKLVADEFFDQGDLE-KLQLNTQPVAMMDRERKDELPKMQVGFIDVICLPLY 934
            :|||:..:.::.|.:|||.|||:| ||:|...|  :.|.| .:.:..:|:||:..:..||:
Zfish   396 RPWELSKQWSEKVTEEFFHQGDIEKKLKLEISP--LCDSE-ANTIASVQIGFMTYVVEPLF 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500 18/117 (15%)
PDEase_I 717..950 CDD:278654 71/220 (32%)
pde7aXP_005162725.1 PDEase_I 239..459 CDD:278654 71/220 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.