DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and pde1b

DIOPT Version :9

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:XP_017946519.1 Gene:pde1b / 100036722 XenbaseID:XB-GENE-987197 Length:554 Species:Xenopus tropicalis


Alignment Length:433 Identity:113/433 - (26%)
Similarity:187/433 - (43%) Gaps:70/433 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   653 VIAEAESYNLYSFTFTDFELVDDDTC--RAVLRMFMQCNLVSQFQIPYDVLCRWVLSVRKNYRPV 715
            |:...:..:|:.|.......|.:|..  ..|..:..:.||.|:|:||...|..::.|:...|...
 Frog   172 VVNSLKHLDLWDFDVFVLNRVSEDHALKTIVFELLSRHNLNSRFKIPVAFLMSFLDSLESGYGKY 236

  Fly   716 K--YHNWRHALNVAQTMFA-MLKTGKMERFMTDLEILGLLVACLCHDLDHRGTNNAFQTKTESPL 777
            |  |||..||.:|.||:.. :|:|| |...:.::|||.::.|...||.:|.||.|:|..:|:|..
 Frog   237 KNPYHNQIHAADVTQTVHCFLLRTG-MVHCLNEIEILAIIFAAAIHDFEHTGTTNSFHIQTKSDC 300

  Fly   778 AILYT-TSTMEHHHFDQCVMILNSEGNNIFQALSPEDYRSVMKTVESAILSTDLAMYF---KKRN 838
            ||||. .|.:|:||......|:..:..|||..|:.:::..:...|...:|:||::.:|   |...
 Frog   301 AILYNDRSVLENHHVSAVYRIMQDDEMNIFVNLTKDEFTELRSLVIEMVLATDMSCHFQQVKTMK 365

  Fly   839 AFLELVENGEFDWQGEEKKDLLCGMMMTACDVSAIAKPWEVQHKVAKLVADEFFDQGDLE-KLQL 902
            ..|:.:|..:        |.....:::.|.|:|...|.|:|..:..|.:.:|||.|||.| ::.|
 Frog   366 TSLQQLETID--------KSKALSLLLHAADISHPTKQWKVHARWTKALMEEFFRQGDKEAEMGL 422

  Fly   903 NTQPVAMMDRERKDEL-PKMQVGFIDVICLPLYRVLCDTFPWITPLYEGTLENRRNWQDLAEKVE 966
            ...|:.    :||..| .:.|:|||:.|..|.:.||                     .|:|||..
 Frog   423 PFSPLC----DRKSTLVAQSQIGFIEFIVDPTFSVL---------------------TDVAEKTV 462

  Fly   967 MGLTWIDHDTIDKPVEEFAACADEEIKDIEFTVTTLNCNQQSQHGSEDSHTPEHQRSGSRLSMKK 1031
            :.|.                   ||....:.|.:....:.|.:..|.|.|:.....:....|.:.
 Frog   463 LPLV-------------------EERSKSKSTASVNQSSSQWRQPSIDDHSEMGDINADIKSFRT 508

  Fly  1032 TGALGKAVRSKLSKTLYNSMDGSKPKTSLKLL----ESHVSED 1070
            |..  |.::....|....:..|...:||:..|    |.|.:|:
 Frog   509 TWT--KYIQENKQKWKERAASGITNQTSVDELSPCEEQHSTEE 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500
PDEase_I 717..950 CDD:278654 74/239 (31%)
pde1bXP_017946519.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.