DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and CYP735A2

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_176882.1 Gene:CYP735A2 / 843031 AraportID:AT1G67110 Length:512 Species:Arabidopsis thaliana


Alignment Length:508 Identity:126/508 - (24%)
Similarity:230/508 - (45%) Gaps:69/508 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTINLLLAVGALF---WIYFLWSRRRLYFLMLK-IPGPIGLPILGSSLE--------------- 46
            :|.|.:.|.:..|:   ..|||..||...|:..: |.||....:.|:.::               
plant    10 VLVIVMTLILRVLYDSICCYFLTPRRIKKFMERQGITGPKPRLLTGNIIDISKMLSHSASNDCSS 74

  Fly    47 ---NIITYKRKLSFRTKYLNKYGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHN----KSQHIV 104
               ||:  .|.|.....:..:||...:.|.|..|.:...:.::::::.:.   ||    ||....
plant    75 IHHNIV--PRLLPHYVSWSKQYGKRFIMWNGTEPRLCLTETEMIKELLTK---HNPVTGKSWLQQ 134

  Fly   105 NAITSCMGNGLLGKQDPHWLDRRKHFNPSFKQDLLLSFF-HIFDAETKVLMNLLDTYVDKGEIDV 168
            ......:|.|||......|..:|....|:|.:|.|..:. |:.:. ||::...|...|.: |:::
plant   135 QGTKGFIGRGLLMANGEAWHHQRHMAAPAFTRDRLKGYAKHMVEC-TKMMAERLRKEVGE-EVEI 197

  Fly   169 VPEMLRWSFKIAAQTTMGSEV-KHDEHFKNGSLVESFESLISHSTLNI------LMPLVQNRMIS 226
            ..||.|.:..|.::|..||.. |..|.|   ||:...:.|.:.:|.::      .:|...||.|.
plant   198 GEEMRRLTADIISRTEFGSSCDKGKELF---SLLTVLQRLCAQATRHLCFPGSRFLPSKYNREIK 259

  Fly   227 KICGYDKLRADNFSRIQKMLDNVVNKKVNPL----PKTDSDPESNIVINRAMELYRKGDITYMDV 287
            .:          .:.::::|..:::.:.:.:    ..:..|....:::|:...  .|.::....:
plant   260 SL----------KTEVERLLMEIIDSRKDSVEIGRSSSYGDDLLGLLLNQMDS--NKNNLNVQMI 312

  Fly   288 KSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGI-TYPDMQKLDYLE 351
            ..||......|::|::|.:...|.|||::|..|:.|.:|:..|   .|..|: :...:..|..|.
plant   313 MDECKTFFFTGHETTSLLLTWTLMLLAHNPTWQDNVRDEVRQV---CGQDGVPSVEQLSSLTSLN 374

  Fly   352 RVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFL 416
            :||.|:|||.|...:..|....|::|.: ::||||:.|.|.:...|.:.|:||.||:.|||:.|.
plant   375 KVINESLRLYPPATLLPRMAFEDIKLGD-LIIPKGLSIWIPVLAIHHSNELWGEDANEFNPERFT 438

  Fly   417 AENM-EQKHPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKISTSTLYK 468
            ..:. ..:|   ::|||.|.|||||..:|||.:|..|..::..:..:.|..|:
plant   439 TRSFASSRH---FMPFAAGPRNCIGQTFAMMEAKIILAMLVSKFSFAISENYR 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 113/465 (24%)
CYP735A2NP_176882.1 PLN02290 2..511 CDD:215164 126/508 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.