DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and CYP97A3

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_564384.1 Gene:CYP97A3 / 840067 AraportID:AT1G31800 Length:595 Species:Arabidopsis thaliana


Alignment Length:485 Identity:110/485 - (22%)
Similarity:179/485 - (36%) Gaps:112/485 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 YGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGKQDPHWLDRRKH 129
            ||.......||..|::..||.:.:.|............:...:...||.||:......|..||:.
plant   139 YGGIFRLTFGPKSFLIVSDPSIAKHILKDNAKAYSKGILAEILDFVMGKGLIPADGEIWRRRRRA 203

  Fly   130 FNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRWSFKIAAQTTMGSEVKHDEH 194
            ..|:..|..:.:...:|...:..|...||....|||                      ||:    
plant   204 IVPALHQKYVAAMISLFGEASDRLCQKLDAAALKGE----------------------EVE---- 242

  Fly   195 FKNGSLVESFESLISHSTLNILMPLVQNRMISKICGYDKLRADN--FSRIQKMLDNVVNKKVNPL 257
                     .|||.|..||:|:...|.|      ..:|.|..|.  ...:..:|....::.|:|:
plant   243 ---------MESLFSRLTLDIIGKAVFN------YDFDSLTNDTGVIEAVYTVLREAEDRSVSPI 292

  Fly   258 PK------TDSDPESNIV------INRAME--------------------------------LYR 278
            |.      .|..|....|      ||..::                                |..
plant   293 PVWDIPIWKDISPRQRKVATSLKLINDTLDDLIATCKRMVEEEELQFHEEYMNERDPSILHFLLA 357

  Fly   279 KG-DITYMDVKSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGV----FPDAGHFG 338
            .| |::...::.:...|:.||::|||..:....:||...|.....:.||::.|    ||      
plant   358 SGDDVSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLTTEPSVVAKLQEEVDSVIGDRFP------ 416

  Fly   339 ITYPDMQKLDYLERVIKETLRLIPAIPITARETKNDVRLSNGVL----IPKGVVIGIDMFHTHRN 399
             |..||:||.|..||:.|:|||.|..|:..|.:     :.|.:|    |.:|..|.|.:::.||:
plant   417 -TIQDMKKLKYTTRVMNESLRLYPQPPVLIRRS-----IDNDILGEYPIKRGEDIFISVWNLHRS 475

  Fly   400 PEVWGPDADNFNPDNFLAEN---MEQKHPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKI 461
            |..| .||:.|||:.:..:.   .|....::|:||..|.|.|||..:|...:..|:..::|.:..
plant   476 PLHW-DDAEKFNPERWPLDGPNPNETNQNFSYLPFGGGPRKCIGDMFASFENVVAIAMLIRRFNF 539

  Fly   462 STSTLYKDLVYVDNMTMKLAEYPRLKLQRR 491
            ..:.....:......|:...|..:|.:.:|
plant   540 QIAPGAPPVKMTTGATIHTTEGLKLTVTKR 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 106/455 (23%)
CYP97A3NP_564384.1 PLN02738 1..595 CDD:215393 110/485 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1194
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.