DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and CYP81F2

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_200532.1 Gene:CYP81F2 / 835828 AraportID:AT5G57220 Length:491 Species:Arabidopsis thaliana


Alignment Length:509 Identity:117/509 - (22%)
Similarity:208/509 - (40%) Gaps:77/509 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ALFWI--YFLWSRRRLYFLMLKIPGPIGLPILGSSLENIITYKRKLSFRTKYLNKYGSTILTWMG 74
            |||.|  .||:|.:...|.:  .|||...||:| .|..:.....:| || ::..|||.......|
plant    11 ALFLIAYKFLFSSKTQGFNL--PPGPTPFPIVG-HLHLVKPPVHRL-FR-RFAEKYGDIFSLRYG 70

  Fly    75 PVPFIVTRDPKVVEDIFSSPD-------CHNKSQHIVNAITSCMGNGLLGKQDPHWLDRRKHFN- 131
            ....:|.....:|.:.|:..:       .|..:...|....:.:|....|   .||.:.|:..: 
plant    71 SRQVVVISSLPLVRESFTGQNDVILTNRPHFLTAKYVAYDYTTIGTAAYG---DHWRNLRRICSL 132

  Fly   132 PSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRWSFK-----IAAQTTMGSEVKH 191
            .....:.|..|..:...|.:.|:..|....|...:::.|.:...:|.     :..:...|.:|.:
plant   133 EILSSNRLTGFLSVRKDEIRRLLTKLSREYDGRVVELEPLLADLTFNNIVRMVTGRRYYGDQVHN 197

  Fly   192 DEH---FKNGSLVESFESLISHSTLNILMPLVQNRMISKICGY---DKLRA-----DNFSRIQKM 245
            .|.   ||  .||.........|.....:|::      |:.|:   .|::|     |.|  :|::
plant   198 KEEANLFK--KLVTDINDNSGASHPGDYLPIL------KVFGHGYEKKVKALGEAMDAF--LQRL 252

  Fly   246 LDNVVNKKVNPLPKTDSDPESNIVINRAMELYRKGDITYMDV--KSECCIMIAAGYDTSALTVYH 308
            ||..   ::|        .|||.:::..:.|.......|.||  |.....|:.||.||:|:|:..
plant   253 LDEC---RIN--------GESNTMVSHLLSLQLDQPKYYSDVIIKGLMLSMMLAGTDTAAVTLEW 306

  Fly   309 ALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYLERVIKETLRLIPAIP-ITARETK 372
            |:..|...||..:....|::....:...  :..||:..|.||:.::.||.||.||.| :..|...
plant   307 AMANLLKKPEVLKKAKAEIDEKIGEERL--VDEPDIANLPYLQNIVSETFRLCPAAPLLVPRSPS 369

  Fly   373 NDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENME-QKHPYAYIPFARGKR 436
            .|::: .|..||:|.::.::.:..||:|.:|.      .|:.|:.|..| |:.....:.|..|:|
plant   370 EDLKI-GGYDIPRGTIVLVNAWAIHRDPRLWD------EPEKFMPERFEDQEASKKLMVFGNGRR 427

  Fly   437 NCIGSKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNMTMKLAEYPRLKLQR 490
            .|.|:.........||..:::.:         |...|:...:.:.|.|.:.:::
plant   428 TCPGATLGQRMVLLALGSLIQCF---------DWEKVNGEDVDMTENPGMAMRK 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 105/457 (23%)
CYP81F2NP_200532.1 p450 1..483 CDD:386267 117/509 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.