DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and CYP735A1

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_198661.1 Gene:CYP735A1 / 833833 AraportID:AT5G38450 Length:518 Species:Arabidopsis thaliana


Alignment Length:527 Identity:127/527 - (24%)
Similarity:221/527 - (41%) Gaps:132/527 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FWIYFLWSRRRLYFLMLK--IPGPIGLPILGSSLE------------------NIITYKRKLSFR 58
            :|:    :.||:..:|.:  :.||...|:.|:.||                  :|:  .|.|...
plant    28 YWL----TPRRIKKIMEQQGVTGPKPRPLTGNILEISAMVSQSASKDCDSIHHDIV--GRLLPHY 86

  Fly    59 TKYLNKYGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHN--------KSQHIVNAITSCMGNGL 115
            ..:..:||...:.|.|..|.:...:.::::::...   ||        :.|...|.|    |.||
plant    87 VAWSKQYGKRFIVWNGTDPRLCLTETELIKELLMK---HNGVSGRSWLQQQGTKNFI----GRGL 144

  Fly   116 LGKQDPHWLDRRKHFNPSFKQDLLLSFF-HIFDAETKVLMNLLDTYVDKG--EIDVVPEMLRWSF 177
            |......|..:|....|:|..:.|..:. |:.:..:| |:..|...|.:|  |:::..||.:.:.
plant   145 LMANGQDWHHQRHLAAPAFTGERLKGYARHMVECTSK-LVERLRKEVGEGANEVEIGEEMHKLTA 208

  Fly   178 KIAAQTTMGSEVKHDEHFKNGSLVESFESLISHSTL----------------------------- 213
            .|.::|..||.      |:.|      :.|.:|.|:                             
plant   209 DIISRTKFGSS------FEKG------KELFNHLTVLQRRCAQATRHLCFPGSRFLPSKYNREIK 261

  Fly   214 -------NILMPLVQNRMISKICGYDKLRADNFSRIQKMLDNVVNKKVNPLPKTDSDPESNIVIN 271
                   .:|:.::|:|......|......|:      :|..::|:.  .:.|.:::..:|:.: 
plant   262 SLKKEVERLLIEIIQSRRDCAEMGRSSTHGDD------LLGLLLNEM--DIDKNNNNNNNNLQL- 317

  Fly   272 RAMELYRKGDITYMDVKSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGH 336
                           :..||.....||::|:||.:.....|||::|..||.|.||:..||   |.
plant   318 ---------------IMDECKTFFFAGHETTALLLTWTTMLLADNPTWQEKVREEVREVF---GR 364

  Fly   337 FGITYPD-MQKLDYLERVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNP 400
            .|:...| :.||..|.:||.|:|||.|...:..|....|::|.: :.||||:.|.|.:...|.:.
plant   365 NGLPSVDQLSKLTSLSKVINESLRLYPPATLLPRMAFEDLKLGD-LTIPKGLSIWIPVLAIHHSE 428

  Fly   401 EVWGPDADNFNPDNFLAENMEQKHPYA----YIPFARGKRNCIGSKYAMMSSKFALCRILRNYKI 461
            |:||.||:.|||:.|      ...|:|    :||||.|.|||||.::|:|.:|..|..::..:..
plant   429 ELWGKDANQFNPERF------GGRPFASGRHFIPFAAGPRNCIGQQFALMEAKIILATLISKFNF 487

  Fly   462 STSTLYK 468
            :.|..|:
plant   488 TISKNYR 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 121/499 (24%)
CYP735A1NP_198661.1 PLN02290 1..518 CDD:215164 127/527 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.