DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and CYP714A2

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_197872.1 Gene:CYP714A2 / 832559 AraportID:AT5G24900 Length:525 Species:Arabidopsis thaliana


Alignment Length:525 Identity:127/525 - (24%)
Similarity:216/525 - (41%) Gaps:131/525 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WSRRRLYFLMLKIPGPIGLP--ILGSSL---------------ENIITYKRKLSFRTKY---LNK 64
            |..||    .||:.|..|.|  |...::               :|||::....|....:   ..:
plant    36 WRMRR----SLKLQGVKGPPPSIFNGNVSEMQRIQSEAKHCSGDNIISHDYSSSLFPHFDHWRKQ 96

  Fly    65 YGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCH-NKSQHIVNAITSCMGNGLLGKQDPHWLDRRK 128
            ||.......|....:....|::|:::..:...: .:..||...:...:|||::....|||..:|:
plant    97 YGRIYTYSTGLKQHLYINHPEMVKELSQTNTLNLGRITHITKRLNPILGNGIITSNGPHWAHQRR 161

  Fly   129 HFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRWSFKIAAQTTMGSEVKHDE 193
            .....|..|           :.|.::.|:   |:    ..:|.:.:|...:.....||.:::.||
plant   162 IIAYEFTHD-----------KIKGMVGLM---VE----SAMPMLNKWEEMVKRGGEMGCDIRVDE 208

  Fly   194 HFKNGSLVESFESLISHSTLNILMPLVQNRMISKIC---GYDKLRADNFSRIQKMLDNVVNKKV- 254
            ..|:                      |...:|:|.|   .:.|.:| .||.|:.:|..:..:.| 
plant   209 DLKD----------------------VSADVIAKACFGSSFSKGKA-IFSMIRDLLTAITKRSVL 250

  Fly   255 ------------------NPLPKTDSDPESNI---VINR-----------AMELYRKGDITYMD- 286
                              ..:...:.:.||:|   |..|           .|:|..:|.:...| 
plant   251 FRFNGFTDMVFGSKKHGDVDIDALEMELESSIWETVKEREIECKDTHKKDLMQLILEGAMRSCDG 315

  Fly   287 -----------VKSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEEL-----NGVFPDAG 335
                       |...|..:..||:|::|::|...|.|||.:|..|..:.:|:     ||: ||| 
plant   316 NLWDKSAYRRFVVDNCKSIYFAGHDSTAVSVSWCLMLLALNPSWQVKIRDEILSSCKNGI-PDA- 378

  Fly   336 HFGITYPDMQKLDYLERVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNP 400
                  ..:..|..:..||:||:||.|..||..||...|:||.: :::||||.|...:...||:|
plant   379 ------ESIPNLKTVTMVIQETMRLYPPAPIVGREASKDIRLGD-LVVPKGVCIWTLIPALHRDP 436

  Fly   401 EVWGPDADNFNPDNFLAENMEQ--KHPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKIST 463
            |:|||||::|.|:.| :|.:.:  |:|.:||||..|.|.|:|..:.||..|..:..|:..:..:.
plant   437 EIWGPDANDFKPERF-SEGISKACKYPQSYIPFGLGPRTCVGKNFGMMEVKVLVSLIVSKFSFTL 500

  Fly   464 STLYK 468
            |..|:
plant   501 SPTYQ 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 120/505 (24%)
CYP714A2NP_197872.1 p450 37..524 CDD:299894 126/524 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.