DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and CYP81F4

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_195457.1 Gene:CYP81F4 / 829895 AraportID:AT4G37410 Length:501 Species:Arabidopsis thaliana


Alignment Length:521 Identity:121/521 - (23%)
Similarity:218/521 - (41%) Gaps:84/521 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 INLLLAVGALFWIYFLWSRRRLYFLMLKIPGP-IGLPILG----------------SSLENIITY 51
            |.|.||:..|.:.:|..|:::.|:|.   |.| ..|||||                |::...|.|
plant     6 IILPLALFLLAYKFFFTSKKQRYYLP---PSPSYSLPILGHHLLIKPPVHRLFHRLSNIHGPIFY 67

  Fly    52 KRKLSFRTKYLNKYGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIVNAITSCMGNGLL 116
            .|..|.|...::........:.|....||:..|:.:...:.       :.:.....|:..|:   
plant    68 LRLGSRRAVVISSSSLARECFTGQNDVIVSNRPRFLTSKYI-------AYNYTTIATTSYGD--- 122

  Fly   117 GKQDPHWLDRRKHFN---PSFKQDLLLSFFHIFDAETKVLMNLL--DTYVDKGEIDVVPEMLRWS 176
                 ||.:.|:..:   .|.|:  |.:|.||...|.:.::..|  |..|.| |:::...:...:
plant   123 -----HWRNLRRICSLEIVSSKR--LANFLHIRKEEIQRMLTRLSRDARVGK-EVELESILYDLT 179

  Fly   177 FK-----IAAQTTMGSEVKHDEHFKNGSLVESFESLISHSTLNILMPLVQNRMISKICGYDKLRA 236
            |.     :..:...|.:|...|.      .|.|:.|.:..|.|     ...|...:...:.|:..
plant   180 FNNIVRMVTGKIYYGDDVSDKEE------AELFKKLFTFITTN-----SGARHPGEYLPFMKIFG 233

  Fly   237 DNFSRIQKMLDNVVNKKVNP-LPKTDSDPESNIVINRAMELYRKGDITYMD--VKSECCIMIAAG 298
            .:|.:..|....|:::.:.. |.:..||.:.|.::|..:.|.:.....|.|  :|.....::.|.
plant   234 GSFEKEVKAAAKVIDEMLQRLLDECKSDKDGNTMVNHLLSLQQDDPEYYTDIIIKGLMLGIMVAS 298

  Fly   299 YDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFG----ITYPDMQKLDYLERVIKETLR 359
            .:|||||:..|:..|.|||:..:.|..|::.:      .|    |...|:..|.||:.|:.||||
plant   299 SETSALTIEWAMASLLNHPKVLDKVKLEIDEI------IGQDRLIEESDIANLPYLQNVVSETLR 357

  Fly   360 LIPAIPI-TARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQK 423
            |.||.|: ..|.|..|::: .|..:|:..::.::.:..||:|::| .:.:.|||:.|.....|:.
plant   358 LHPAAPVLVPRSTAEDIKI-GGYDVPRDTMVMVNAWAIHRDPDLW-TEPERFNPERFNGGEGEKD 420

  Fly   424 HPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNMTMKLAEYPRLKL 488
            .....|.|..|:|.|.|...|......||..:::.:         |...|:...:.::|.|.:.:
plant   421 DVRMLIAFGSGRRICPGVGLAHKIVTLALGSLIQCF---------DWKKVNEKEIDMSEGPGMAM 476

  Fly   489 Q 489
            :
plant   477 R 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 108/464 (23%)
CYP81F4NP_195457.1 CYP81 63..482 CDD:410746 104/461 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.