DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and CYP81D8

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_195453.1 Gene:CYP81D8 / 829891 AraportID:AT4G37370 Length:497 Species:Arabidopsis thaliana


Alignment Length:493 Identity:111/493 - (22%)
Similarity:194/493 - (39%) Gaps:109/493 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LTINLLLAVGALFWIYFLWSRRRLYFLMLKIPGPI-GLPILG-----------------SSLENI 48
            |..::|..|.:|  ||.:...:|...|.   |.|. .||::|                 .||.|.
plant     6 LIFSILFVVLSL--IYLIGKLKRKPNLP---PSPAWSLPVIGHLRLLKPPIHRTFLSLSQSLNNA 65

  Fly    49 ITYKRKLSFRTKYLNKYGSTILTWMGPVPFIVTRDPKVVEDIFSSPD--CHNK-----SQHIVNA 106
            ..:..:|..|..::|...|                  :.|:.|:..|  ..|:     ::|:...
plant    66 PIFSLRLGNRLVFVNSSHS------------------IAEECFTKNDVVLANRPNFILAKHVAYD 112

  Fly   107 ITSCMGNGLLGKQDPHWLDRRKHFNPS-FKQDLLLSFFHIFDAETKVLM-----NLLDTYVDKGE 165
            .|:.    :......||.:.|:..:.. |....|.||..|...|.:.|:     |....:|   :
plant   113 YTTM----IAASYGDHWRNLRRIGSVEIFSNHRLNSFLSIRKDEIRRLVFRLSRNFSQEFV---K 170

  Fly   166 IDVVPEMLRWSFK-----IAAQTTMGSEVKHDEHFKN-GSLVESFESLISHSTLNILMPLVQNRM 224
            :|:...:...:|.     :|.:...|..|:.|...|. ..|:....:..........:|::  |:
plant   171 VDMKSMLSDLTFNNILRMVAGKRYYGDGVEDDPEAKRVRQLIADVVACAGAGNAVDYLPVL--RL 233

  Fly   225 IS-------KICGYDKLRADNFSRIQKMLDNVVNKKVNPLPKTDSDPESNIVINRAMELYRKGDI 282
            :|       |:.|    |.|.|  :|.::|.          |.::..:.|.:|:..:.|......
plant   234 VSDYETRVKKLAG----RLDEF--LQGLVDE----------KREAKEKGNTMIDHLLTLQESQPD 282

  Fly   283 TYMD--VKSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGI----TY 341
            .:.|  :|.....:|.||.||||:|:..||..:.|||:......:|::      ...|:    ..
plant   283 YFTDRIIKGNMLALILAGTDTSAVTLEWALSNVLNHPDVLNKARDEID------RKIGLDRLMDE 341

  Fly   342 PDMQKLDYLERVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPD 406
            .|:..|.||:.::.|||||.||.|:......::.....|..:|:|.::..:::..||:|::| .|
plant   342 SDISNLPYLQNIVSETLRLYPAAPMLLPHVASEDCKVAGYDMPRGTILLTNVWAIHRDPQLW-DD 405

  Fly   407 ADNFNPDNFLAENMEQKHPYAYIPFARGKRNCIGSKYA 444
            ..:|.|:.|..|...||    .:||..|:|.|.||..|
plant   406 PMSFKPERFEKEGEAQK----LMPFGLGRRACPGSGLA 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 103/462 (22%)
CYP81D8NP_195453.1 p450 5..487 CDD:299894 111/493 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.