DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and CYP706A5

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_192968.3 Gene:CYP706A5 / 826840 AraportID:AT4G12310 Length:520 Species:Arabidopsis thaliana


Alignment Length:494 Identity:121/494 - (24%)
Similarity:203/494 - (41%) Gaps:78/494 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLAVGALFWIYFLWSRRRLYFLMLKIPGPIGLPILGS--SLE-NIITYKRKLSFRTKYLNKYGS 67
            :|.|..::.|..|..|.:...     .|||.||||:|:  .|: ::.||..||:      ..:|.
plant    24 ILTATFSILWYIFKRSPQPPL-----PPGPRGLPIVGNLPFLDPDLHTYFTKLA------QSHGP 77

  Fly    68 TILTWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIV----NAITSCMGNGLLGKQDPHWLD--- 125
            .....:|....:|...|.:..:|....|. |.|.|.|    .|:|       .|..|..||.   
plant    78 IFKLNLGSKLTVVVNSPSLASEILKDQDI-NFSNHDVPLTARAVT-------YGGLDLVWLPYGA 134

  Fly   126 -----RRKHFNPSFKQDLLLSFFHIFDAETKVLMN-LLDTYVDKGEIDVVPEMLRWSFKIAAQTT 184
                 |:......|.:..|.||:.:...|.:.... |....::|..::|..::......:.....
plant   135 EWRMLRKVCAAKLFSRKTLDSFYELRRKEIRERTRCLYQKGLEKSPVNVGEQLFLTMMNLMMNML 199

  Fly   185 MGSEVKHDEHFKNGSLVESFESLISHSTLNILMPLVQN--RMISKICGYDKLRADNFSRIQKM-- 245
            .|..||.::....|:   .|:.:||..|..:.:|.|.:  .|::        |.|....::||  
plant   200 WGGSVKAEDMESVGT---EFKGVISEITRLLGVPNVSDFFPMLA--------RFDLQGLVKKMHL 253

  Fly   246 ----LDNVVNKKVNPLPKTDS----DPESNIVINRAMELY-RKGD----ITYMDVKSECCIMIAA 297
                ||.::::.:..:.:..|    |.|....:...|:|. ::.|    ||...||:....|:..
plant   254 YARDLDAILDRAIEQMQRLRSRDGDDGECKDFLQHLMKLRDQEADSDVPITMNHVKAVLMDMVVG 318

  Fly   298 GYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPD-MQKLDYLERVIKETLRLI 361
            |.::|..|:...:..|.::||......:||:.|   .|...|.... :..|.|:..|:||||||.
plant   319 GTESSTNTIEFVMAELISNPELMRRAQQELDEV---VGKDNIVEESHITSLPYILAVLKETLRLY 380

  Fly   362 PAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQKH-- 424
            |.||:......::..|..|..|||...|.|:::...|:|.||....: |.|:.||    ::|.  
plant   381 PTIPLLVPHRPSETALVGGYTIPKNTKIFINVWSIQRDPNVWEYPTE-FRPERFL----DKKSCD 440

  Fly   425 ----PYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNY 459
                .|:|:||..|:|.|.|...|.....:.|..:|.::
plant   441 FTGTDYSYLPFGSGRRICAGIALAERMILYTLATLLHSF 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 116/467 (25%)
CYP706A5NP_192968.3 p450 53..518 CDD:299894 110/460 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.