DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and CYP72A11

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_188083.1 Gene:CYP72A11 / 820693 AraportID:AT3G14650 Length:512 Species:Arabidopsis thaliana


Alignment Length:521 Identity:123/521 - (23%)
Similarity:223/521 - (42%) Gaps:84/521 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LTINLLLAVGALFWIY----FLWSRRRLYFLMLKIPGPIG---LPILGSSLENIITYKRKLSFRT 59
            :|:::.:.| ..:|::    ::|.:.::....|:..|..|   .|::|...:|   :..:...|:
plant     8 VTVSVAVVV-VSWWVWRTLQWVWFKPKMLESYLRRQGLAGTPYTPLVGDLKKN---FSMRAEARS 68

  Fly    60 KYLN------------------KYGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIVNA 106
            |.:|                  .:|.|..||.|.:|.|...||:.:.::.      ||......|
plant    69 KPINLTDDITPRIVPYPLQMLKTHGRTFFTWFGAIPTITIMDPEQITEVL------NKVYDFQKA 127

  Fly   107 ITSCMG----NGLLGKQDPHWLDRRKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYV-DKG-- 164
            .|..:|    .|:|......|...|:..||:|..:.:.:....|......::...|..| ||.  
plant   128 HTFPLGRLIATGVLSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEIVCKWDKLVSDKESS 192

  Fly   165 -EIDVVPEMLRWSFKIAAQTTMGSEVKHDEHFKNGSLVES---FESLISHSTLNILMPLVQNRMI 225
             |:||.|.::..:..:.::|..||           |.||.   ||  :......:::..|:...|
plant   193 CEVDVWPGLVSMTADVISRTAFGS-----------SCVEGQRIFE--LQAELAQLIIQTVRKAFI 244

  Fly   226 SKICGYDKLRADNFSR-------IQKMLDNVVNKKV--NPLPKTDSDPESNIVINRAMELYRKGD 281
            .   ||..|......|       ||.:|..:|||::  ....:..:|....|::...:...:...
plant   245 P---GYSYLPTKGNRRMKAKAREIQVILRGIVNKRLRAREAGEAPNDDLLGILLESNLGQTKGNG 306

  Fly   282 ITYMDVKSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQK 346
            ::..|:..||.:....|.:|:::.:...:.||:.|.:.|....||:..||.|      ..||.:.
plant   307 MSTEDLMEECKLFYFVGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGD------KEPDAEG 365

  Fly   347 LDYLE---RVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDAD 408
            |:.|:   .::.|.|||.|.||..:|....::.|.: :.:|.||:|.:.:....|:.|:||.||.
plant   366 LNQLKVMTMILYEVLRLYPPIPQLSRAIHKEMELGD-LTLPGGVLINLPILLVQRDTELWGNDAG 429

  Fly   409 NFNPDNFLAENMEQ--KHPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKISTSTLYKDLV 471
            .|.||.| .:.:.:  |:..::.|||.|.|.|||..:|::.:|.|:..||:.:....|..|....
plant   430 EFKPDRF-KDGLSKATKNQASFFPFAWGSRICIGQNFALLEAKMAMALILQRFSFELSPSYVHAP 493

  Fly   472 Y 472
            |
plant   494 Y 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 115/475 (24%)
CYP72A11NP_188083.1 p450 24..512 CDD:299894 120/504 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.