DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and CYP709B2

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_182218.2 Gene:CYP709B2 / 819309 AraportID:AT2G46950 Length:572 Species:Arabidopsis thaliana


Alignment Length:536 Identity:141/536 - (26%)
Similarity:220/536 - (41%) Gaps:98/536 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTINLLLAV-----GA---LFWIYFLWSRRRLYFLMLKIPGP------------------IGLP 39
            :|.|.|:|.|     ||   |.|..::.|||   |....|.||                  ..|.
plant    64 LLAIALVLLVVPKIYGACRILVWRPWMLSRR---FKKQGISGPKYRILYGNLREIRKMKNEAKLM 125

  Fly    40 ILGSSLENIITYKRKLSFRTKYLNKYGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIV 104
            :|..:..:|:  .|.|....::.::||.|.|.|.|..|.:...|.::.:.|.|:...........
plant   126 VLDPNSNDIV--PRVLPHLQQWKSQYGETFLYWQGTDPRLCISDHELAKQILSNKFVFFSKSKTK 188

  Fly   105 NAITSCMGNGLLGKQDPHWLDRRKHFNPSFKQDLLLSF--------FHIFDAETKVLMNLLDTYV 161
            ..|....||||:......|:..|:..||:|..|.|...        |.:| .|.|...|.::|  
plant   189 PEILKLSGNGLIFVNGLDWVRHRRILNPAFSMDKLKLMTQLMVDCTFRMF-LEWKKQRNGVET-- 250

  Fly   162 DKGEIDVVPEMLRWSFKIAAQTTMGSEVKHDEHFKNGSLVESFESLISHSTLNILMPLVQNRMIS 226
             :..:.:..|..|.:..|.|....||.      :..|  :|.|:|.:.               :.
plant   251 -EQFVLISREFKRLTADIIATAAFGSS------YAEG--IEVFKSQLE---------------LQ 291

  Fly   227 KIC----------GYDKLRADNFSRIQKMLDNVVNKKVNPLPKTDSDPES--------NIVINRA 273
            |.|          |...|...:..:|.| ||..||..:..:.......||        .|::..|
plant   292 KCCAAALTDLYFPGIQYLPTPSNLQIWK-LDMKVNSSIKRIIDARLTSESKDYGNDLLGIMLTAA 355

  Fly   274 MELYRKGDITYMDVKSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFG 338
            .....:..::..::..||.....||::|:|..:..:..||:.|.:.||.:.||   ||.:.|...
plant   356 SSNESEKKMSIDEIIEECKTFFFAGHETTANLLTWSTMLLSLHQDWQEKLREE---VFNECGKDK 417

  Fly   339 ITYPDMQ---KLDYLERVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNP 400
            |  ||.:   ||..:..|..|:|||...:....|....|::|.| :.||||..|.:.:...||:.
plant   418 I--PDAETCSKLKLMNTVFMESLRLYGPVLNLLRLASEDMKLGN-LEIPKGTTIILPIAKMHRDK 479

  Fly   401 EVWGPDADNFNPDNFLAENMEQ--KHPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKIST 463
            .|||.|||.|||..| |..:.:  .||.|.:.|:.|.|.|||..:|:|.:|..|..||:.::::.
plant   480 AVWGSDADKFNPMRF-ANGLSRAANHPNALLAFSMGPRACIGQNFAIMEAKTVLAMILQRFRLNL 543

  Fly   464 STLYKDLVYVDNMTMK 479
            |..||. ...|::|::
plant   544 SADYKH-APADHLTLQ 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 122/478 (26%)
CYP709B2NP_182218.2 p450 89..571 CDD:299894 132/511 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.