DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001003947.1 Gene:Cyp4x1 / 81906 MGIID:1932403 Length:507 Species:Mus musculus


Alignment Length:475 Identity:125/475 - (26%)
Similarity:209/475 - (44%) Gaps:68/475 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RRRLYFLMLKIPGPIGLPILG----------SSLENIITYKRKLSFRTKYLNKYGSTILTWMGPV 76
            |:||...:...|||....:||          .:|:.|:             .|:......|:||.
Mouse    36 RQRLLRDLSPFPGPPAHWLLGHQKFLQEDNMETLDEIV-------------KKHPCAFPCWVGPF 87

  Fly    77 -PFIVTRDPKVVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGKQDPHWLDRRKHFNPSFKQDLLL 140
             .|....||...:...|..|  .|.|::...:|.|:|.|||....|.|...|....|:|.||:|.
Mouse    88 QAFFYIYDPDYAKIFLSRTD--PKMQYLHQLLTPCIGRGLLNLDGPRWFQHRCLLTPAFHQDILK 150

  Fly   141 SFFHIFDAETKVLMNLLDTYVDKGE---------IDVVPEMLRWSFKIAAQTTMGSEVKHDEHFK 196
            ..........||::       ||.|         |:|...:...:..|..:...|.|.       
Mouse   151 PCVDTMAHSVKVML-------DKWEKMWTTQETTIEVFEHINLMTLDIIMKCAFGQET------- 201

  Fly   197 NGSLVESFESLISHSTLNILMPLVQNRMISKICGYD---KL--RADNFSRIQKMLDNVVNKKVNP 256
            |..:..::||.:. :|.. |..::.:|:.:....:|   ||  :...|..:.|::.....|.:..
Mouse   202 NCQINGTYESYVK-ATFE-LGEIISSRLYNFWHHHDIIFKLSPKGHCFQELGKVIHQYTEKIIQD 264

  Fly   257 LP-------KTDSDPESNIVINRAMELYRKGDITY--MDVKSECCIMIAAGYDTSALTVYHALFL 312
            ..       |.|....|.|.::..:....:.:..:  .|:::|....:.||:|.||.::...|:.
Mouse   265 RKKILKNQVKQDDTQTSQIFLDIVLSAQAEDERAFSDADLRAEVNTFMWAGHDASAASISWLLYC 329

  Fly   313 LANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYLERVIKETLRLIPAIPITARETKNDVRL 377
            ||.:||||:....|:..:..|..  .||:..:.::.|....|||||||||.:|..:||....:.|
Mouse   330 LALNPEHQDRCRTEIRSILGDGS--SITWEQLDEMSYTTMCIKETLRLIPPVPSISRELSKPLTL 392

  Fly   378 SNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQKHPYAYIPFARGKRNCIGSK 442
            .:|..:|.|:.:.:.::..|.||.||. |...|:|..|..||.:|:||.|::||:.|.|||||.:
Mouse   393 PDGHSLPAGMTVVLSIWGLHHNPAVWN-DPKVFDPLRFTKENSDQRHPCAFLPFSSGPRNCIGQQ 456

  Fly   443 YAMMSSKFALCRILRNYKIS 462
            :||:..|.|:..||.:::::
Mouse   457 FAMLELKVAIALILLHFQVA 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 122/464 (26%)
Cyp4x1NP_001003947.1 p450 47..499 CDD:278495 122/464 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.