DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and C4H

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_180607.1 Gene:C4H / 817599 AraportID:AT2G30490 Length:505 Species:Arabidopsis thaliana


Alignment Length:469 Identity:111/469 - (23%)
Similarity:197/469 - (42%) Gaps:66/469 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LKI-PGPIGLPILGSSLE--------NIITYKRKLSFRTKYLNKYGSTILTWMGPVPFIVTRDPK 85
            ||: ||||.:||.|:.|:        |::.|.:          |:|...|..||....:|...|.
plant    31 LKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAK----------KFGDLFLLRMGQRNLVVVSSPD 85

  Fly    86 VVEDIF--SSPDCHNKSQHIVNAITSCMGNGLL----GKQDPHWLDRRKHFN-PSFKQDLLLSFF 143
            :.:::.  ...:..::::::|..|.:..|..::    |:   ||...|:... |.|...::....
plant    86 LTKEVLLTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGE---HWRKMRRIMTVPFFTNKVVQQNR 147

  Fly   144 HIFDAETKVLMNLLDTYVDKGEIDVVPEMLRWSFKIAAQTTMGSEVKHDEHFK------------ 196
            ..::.|...::..:....|.....:|   ||...::.....| ..:..|..|:            
plant   148 EGWEFEAASVVEDVKKNPDSATKGIV---LRKRLQLMMYNNM-FRIMFDRRFESEDDPLFLRLKA 208

  Fly   197 -NGS---LVESFESLISHSTLNILMPLVQNRMISKICGYDKLRADNFSRIQKMLDNVVNKKVNPL 257
             ||.   |.:|||.... ..:.||.|.::..:  |||...|.|     ||.......|:::....
plant   209 LNGERSRLAQSFEYNYG-DFIPILRPFLRGYL--KICQDVKDR-----RIALFKKYFVDERKQIA 265

  Fly   258 PKTDSDPES-NIVINRAMELYRKGDITYMDVKSECCIMIAAGYDTSALTVYHALFLLANHPEHQE 321
            ....:..|. ...|:..:|..:||:|...:|......:..|..:|:..::...:..|.||||.|.
plant   266 SSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQS 330

  Fly   322 AVFEELNGVFPDAGHFGITYPDMQKLDYLERVIKETLRLIPAIPITARETK-NDVRLSNGVLIPK 385
            .:..||:.|....  ..:|.||:.||.||:.|:||||||..|||:...... :|.:|: |..||.
plant   331 KLRNELDTVLGPG--VQVTEPDLHKLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLA-GYDIPA 392

  Fly   386 GVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQK---HPYAYIPFARGKRNCIGSKYAMMS 447
            ...|.::.:....||..| ...:.|.|:.|..|....:   :.:.|:||..|:|:|.|...|:..
plant   393 ESKILVNAWWLANNPNSW-KKPEEFRPERFFEEESHVEANGNDFRYVPFGVGRRSCPGIILALPI 456

  Fly   448 SKFALCRILRNYKI 461
            ....:.|:::|:::
plant   457 LGITIGRMVQNFEL 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 109/465 (23%)
C4HNP_180607.1 PLN02394 3..505 CDD:215221 111/469 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.