DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and CYP94C1

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_180337.1 Gene:CYP94C1 / 817315 AraportID:AT2G27690 Length:495 Species:Arabidopsis thaliana


Alignment Length:421 Identity:102/421 - (24%)
Similarity:178/421 - (42%) Gaps:56/421 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 IVTRDPKVVEDIFSSPDCHN--KSQHIVNAITSCMGNGLLGKQDPHWLDRRKHFNPSFKQDLLLS 141
            ::|.:|..||.|..: :.||  |.:.....:...:|.|:.......|..:||..:.......:..
plant    76 VITANPSNVEHILKT-NFHNYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRV 139

  Fly   142 FFHIF---DAETKVLMNLLDTYVDK--GEIDVVPEMLRWSFKIAAQTTMGSEVKHDEHFKNGSLV 201
            |.|..   :.||: |:.:|.::.|.  ..:|:.....|:||...::.:.|        |....|.
plant   140 FAHEIVKTEIETR-LLPILTSFSDNPGSVLDLQDVFRRFSFDTISKLSFG--------FDPDCLR 195

  Fly   202 ESF---ESLISHSTLNIL--------MPLV--QNRMISKICGYDKLRADNFSRIQKMLDNVVNKK 253
            ..|   |..::..|.::|        .||:  ..|:         ||..:..::|:.: ||:|:.
plant   196 LPFPISEFAVAFDTASLLSAKRALAPFPLLWKTKRL---------LRIGSEKKLQESI-NVINRL 250

  Fly   254 VNPLPK---TDSDPESNIVINRAMELYRKGDITYMDVKSECCIMIAAGYDTSALTVYHALFLLAN 315
            ...|.|   .......|.:|:|.|.:..:.|..|:  :......:.||.||.|..:....:||..
plant   251 AGDLIKQRRLTGLMGKNDLISRFMAVVAEDDDEYL--RDIVVSFLLAGRDTVAAGLTGFFWLLTR 313

  Fly   316 HPEHQEAVFEELNGVFPDAGHFGIT--YPDMQKLDYLERVIKETLRLIPAIPITARETKNDVRLS 378
            |||.:..:.|||:.|. ..|...:|  ..:|:::|||...:.|::||.|.:...::...||..||
plant   314 HPEVENRIREELDRVM-GTGFDSVTARCDEMREMDYLHASLYESMRLFPPVQFDSKFALNDDVLS 377

  Fly   379 NGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAE--NMEQKHPYAYIPFARGKRNCIGS 441
            :|..:..|..:....:...|...:||||.:.|.|:.:|..  ....::|..|..|..|.|.|||.
plant   378 DGTFVNSGTRVTYHAYAMGRMDRIWGPDYEEFKPERWLDNEGKFRPENPVKYPVFQAGARVCIGK 442

  Fly   442 KYAMMSSKFALCRILRNYKI------STSTL 466
            :.|:|..|.....|:|.::.      :|.||
plant   443 EMAIMEMKSIAVAIIRRFETRVASPETTETL 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 99/416 (24%)
CYP94C1NP_180337.1 PLN02426 23..495 CDD:215235 102/421 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1194
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.