DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and CYP81D7

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_179900.1 Gene:CYP81D7 / 816851 AraportID:AT2G23190 Length:543 Species:Arabidopsis thaliana


Alignment Length:485 Identity:111/485 - (22%)
Similarity:199/485 - (41%) Gaps:78/485 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTINLLLAVGALFWI--YFLWSRRRLYFLMLKIPGPI-GLPILGSSLENIITYKRKLSFRTKYL 62
            |.|..|:|::..||:|  ..|:.:|...|.:  .|.|. .||.:|    ::...|:.|.      
plant    45 METHFLILSLAFLFFISLKLLFGKRHSKFNL--PPSPARPLPFIG----HLHLLKQPLH------ 97

  Fly    63 NKYGSTILTW---MGPVPF----------IVTRDPKVVEDIFSSPD--CHNK-----SQHIVNAI 107
                .|.|::   :|..|.          :|.....:.|:.|:..|  ..|:     .:||....
plant    98 ----RTFLSFSQSLGDAPIFSLRLGNHLTVVVSSYSIAEECFTKNDIVLANRPKFILGKHIEYNF 158

  Fly   108 TSCMGNGLLGKQDPHWLD-RRKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPE 171
            |: |.:...|   .||.: ||......|....|..|..:...|.:.|:..|......|...|...
plant   159 TT-MTSAPYG---DHWRNLRRIGTLEIFSSHKLNGFLSVRKDEIRHLLLRLSKNSQHGFAKVEMR 219

  Fly   172 MLRWSFKI-------AAQTTMGSEVKHDEHFKNGSLVESFESLISHSTLNILMPLVQNRMISKIC 229
            .|.:...|       |.:...|...:.||..:.  :.:..:.::..:.:......:.  ::..|.
plant   220 QLFYDLTINNILRMVAGKRFYGEGTEQDEVARR--VTQLIDEIVYRAGVGNAADYIP--ILRWIT 280

  Fly   230 GYDKLRADNFSRIQKMLDNVVN-KKVNPLPKTDSDPESNIVINRAMELYRKGDITYMDV--KSEC 291
            .::|...:..||:.:.|.::|: ::|:       ..:.|.:::..:.|.......|.||  |...
plant   281 DFEKGVKELASRVDEFLQSLVDERRVH-------KQKGNTMMDHLLSLQETQPDYYTDVTLKGII 338

  Fly   292 CIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGI-TYPDMQKLDYLERVIK 355
            .:||.||.:|.|.|:..|:..|.||||..|....|::   .:.|...: ...|.:.|.||:.::.
plant   339 IVMILAGTETLAGTLEWAMLNLLNHPEVLEKARTEID---TEVGFDRLMDEADTKNLPYLQWIVL 400

  Fly   356 ETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVW-GPDADNFNPDNFLAEN 419
            |||||.|..|.......:|..:..|..:|:|.::.::::..||:|.:| .|:.  |.|:.|..|.
plant   401 ETLRLYPVAPTNIPHMTSDDCILAGYDVPRGSMLLVNVWSMHRDPSIWEAPEM--FKPERFKNEK 463

  Fly   420 MEQKHPYAYIPFARGKRNC--IGSKYAMMS 447
            :.||    .:.|..|:|.|  :|..:.:||
plant   464 LNQK----LLSFGFGRRACPGVGLAHRLMS 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 101/451 (22%)
CYP81D7NP_179900.1 p450 43..502 CDD:299894 111/485 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.