DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and CYP4F12

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_076433.3 Gene:CYP4F12 / 66002 HGNCID:18857 Length:524 Species:Homo sapiens


Alignment Length:492 Identity:126/492 - (25%)
Similarity:212/492 - (43%) Gaps:60/492 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLAVGA------LFWIYFLWSRRRLYFLMLKIP------GPIGLPILGSSLENIITYKRKLSFR 58
            |||.||:      |.|.|..::..|......:.|      |.:||         |...:..|...
Human    22 LLLVVGSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWFWGHLGL---------ITPTEEGLKNS 77

  Fly    59 TKYLNKYGSTILTWMGP-VPFIVTRDPKVVEDIF-SSPDCHNKSQHIVNAITSCMGNGLLGKQDP 121
            |:....|......|:|| :||||...|..:..|. :|.....|....:..:...:|.|:|.....
Human    78 TQMSATYSQGFTVWLGPIIPFIVLCHPDTIRSITNASAAIAPKDNLFIRFLKPWLGEGILLSGGD 142

  Fly   122 HWLDRRKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKG--EIDVVPEMLRWSFKIAAQTT 184
            .|...|:...|:|..::|.|:..||:....::::.......:|  .:|:        |:..:..|
Human   143 KWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQHLASEGSSRLDM--------FEHISLMT 199

  Fly   185 MGSEVK----HDEHFKN------GSLVESFESLISHSTLNILMPLVQNRMISKICGYDKLRADNF 239
            :.|..|    .|.|.:.      .:::| ..:|:...:.:||    |:........:|..|....
Human   200 LDSLQKCIFSFDSHCQERPSEYIATILE-LSALVEKRSQHIL----QHMDFLYYLSHDGRRFHRA 259

  Fly   240 SR-IQKMLDNVVNKKVNPLPK-------TDSDPESNIVINRAMELYRKGD---ITYMDVKSECCI 293
            .| :....|.|:.::...||.       .|......:.....:.|.:..|   ::..|:::|...
Human   260 CRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDVLLLSKDEDGKALSDEDIRAEADT 324

  Fly   294 MIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYLERVIKETL 358
            .:..|:||:|..:...|:.||.|||:||...:|:..:..|.....|.:.|:.:|.:|...:||:|
Human   325 FMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDRDPKEIEWDDLAQLPFLTMCVKESL 389

  Fly   359 RLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQK 423
            ||.|..|..:|....|:.|.:|.:||||:...||:...|.||.|| ||.:.::|..|..||.:.:
Human   390 RLHPPAPFISRCCTQDIVLPDGRVIPKGITCLIDIIGVHHNPTVW-PDPEVYDPFRFDPENSKGR 453

  Fly   424 HPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYK 460
            .|.|:|||:.|.|||||..:||...|..|..:|.:::
Human   454 SPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFR 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 117/459 (25%)
CYP4F12NP_076433.3 p450 52..506 CDD:306555 117/462 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.