DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and CYP26B1

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_063938.1 Gene:CYP26B1 / 56603 HGNCID:20581 Length:512 Species:Homo sapiens


Alignment Length:520 Identity:117/520 - (22%)
Similarity:204/520 - (39%) Gaps:94/520 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTINLLLAVGALFWIYFLWSRRRLYFLMLKIP-GPIGLPILGSSLENIITYKRKLSFRTKYLNK 64
            ::::.|||||....| ...|:..|.....|.|| |.:|.|::|.:...::   :...|::....|
Human    19 LVSVTLLLAVSQQLW-QLRWAATRDKSCKLPIPKGSMGFPLIGETGHWLL---QGSGFQSSRREK 79

  Fly    65 YGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIV--------------NAITSCMGNGL 115
            ||:...|.:...|.|.....:.|..|...      ..|:|              |.:::.:|   
Human    80 YGNVFKTHLLGRPLIRVTGAENVRKILMG------EHHLVSTEWPRSTRMLLGPNTVSNSIG--- 135

  Fly   116 LGKQDPHWLDRRKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDT---YVDKGE-IDVVPEMLRWS 176
                |.| .::||.|:..|..:.|.|:.      .|:.:.:.||   :....| |:|..|..:.:
Human   136 ----DIH-RNKRKVFSKIFSHEALESYL------PKIQLVIQDTLRAWSSHPEAINVYQEAQKLT 189

  Fly   177 FKIAAQTTMGSEVKHDEHFKNGSLVESFESLISH-STLNILMPL------VQNRMISKICGYDKL 234
            |::|.:..:|..:..::   .|.|.|.::..:.: .:|.:.:|.      :|.|.|         
Human   190 FRMAIRVLLGFSIPEED---LGHLFEVYQQFVDNVFSLPVDLPFSGYRRGIQARQI--------- 242

  Fly   235 RADNFSRIQKMLDNVVNKKVNPLPKTDSDPESNIVINRAMELYRKGDITYMDVKSECCIMIAAGY 299
                   :||.|:..:.:|:......|.....:::|..:.|  ...::|..::|.....:|.|.|
Human   243 -------LQKGLEKAIREKLQCTQGKDYLDALDLLIESSKE--HGKEMTMQELKDGTLELIFAAY 298

  Fly   300 DTSALTVYHALFLLANHPEHQEAVFEEL--NGVFPDAG---HFGITYPDMQKLDYLERVIKETLR 359
            .|:|......:..|..||...|.:.:||  :|:....|   ...:....:..|.||:.||||.:|
Human   299 ATTASASTSLIMQLLKHPTVLEKLRDELRAHGILHSGGCPCEGTLRLDTLSGLRYLDCVIKEVMR 363

  Fly   360 LIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQKH 424
            |...|....|.......| :|..||||..:...:..||....|: .|.:.|:||.|.....|.|.
Human   364 LFTPISGGYRTVLQTFEL-DGFQIPKGWSVMYSIRDTHDTAPVF-KDVNVFDPDRFSQARSEDKD 426

  Fly   425 -PYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNMTMKLAEYPRLKL 488
             .:.|:||..|.|.|:|...|               |:....|..:|.......:....:||:.|
Human   427 GRFHYLPFGGGVRTCLGKHLA---------------KLFLKVLAVELASTSRFELATRTFPRITL 476

  Fly   489  488
            Human   477  476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 102/461 (22%)
CYP26B1NP_063938.1 p450 23..490 CDD:325183 117/516 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4824
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.