DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and Cyp4c3

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster


Alignment Length:523 Identity:153/523 - (29%)
Similarity:251/523 - (47%) Gaps:50/523 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LTINLLLAVGALFWIYFLWSRRRLYFLMLKIPGPIGLPILGSSLENIITYKRKLSFRTKYLNKYG 66
            :|:.||.:: .:|.:.:...|.||...:.|||||..:|.||:::|..:.:. :|..|...:.|..
  Fly    29 ITVFLLGSI-LIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNVDHD-ELFNRVIGMQKLW 91

  Fly    67 STIL----TWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGKQDPHWLDRR 127
            .|.:    .|.|..|.::..:|:.||.|.:|....||| |..:.:...:|.|||...|..|..||
  Fly    92 GTRIGINRVWQGTAPRVLLFEPETVEPILNSQKFVNKS-HDYDYLHPWLGEGLLTSTDRKWHSRR 155

  Fly   128 KHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRWSFKIAAQTTMGSEV--- 189
            |...|:|...:|..|..:|:.::.||...|...|.....::.|.:...:..|..:|.||..:   
  Fly   156 KILTPAFHFKILDDFIDVFNEQSAVLARKLAVEVGSEAFNLFPYVTLCTLDIVCETAMGRRIYAQ 220

  Fly   190 --KHDEHFKN----GSLVESFESLISHSTLNILMPLVQNRMISKICGYDKLRADNFSRIQKMLDN 248
              ...|:.|.    ||:|:|.::.|          .:|:..|..:....||.....:.:....:.
  Fly   221 SNSESEYVKAVYGIGSIVQSRQAKI----------WLQSDFIFSLTAEYKLHQSYINTLHGFSNM 275

  Fly   249 VVNKKVNPLPKTDSDPESNIVINRAMELY----RKGDITYM----------------DVKSECCI 293
            |:.::...|.....:..:|  .|.|.:.|    :|..:.::                |::.|...
  Fly   276 VIRERKAELAILQENNNNN--NNNAPDAYDDVGKKKRLAFLDLLIDASKEGTVLSNEDIREEVDT 338

  Fly   294 MIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYLERVIKETL 358
            .:..|:||::..:...||||..|||:||.|.|||:.:|.|......|..::..:.|||..||::|
  Fly   339 FMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSL 403

  Fly   359 RLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQK 423
            ||.|::|:.||....||.: .|.::|.|....|..:..||||.|: |..:.|||||||.||...:
  Fly   404 RLFPSVPMMARMVGEDVNI-GGKIVPAGTQAIIMTYALHRNPRVF-PKPEQFNPDNFLPENCAGR 466

  Fly   424 HPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNMTMKLAEYPRLKL 488
            ||:|||||:.|.|||||.|:|::..|..:..:||.|||......:||..:..:.::..:..|:|:
  Fly   467 HPFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPKDGLRVKI 531

  Fly   489 QRR 491
            ..|
  Fly   532 TPR 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 139/462 (30%)
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 142/487 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I1781
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1194
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
65.860

Return to query results.
Submit another query.