DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and Cyp4a30b

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:XP_006503285.1 Gene:Cyp4a30b / 435802 MGIID:3717145 Length:510 Species:Mus musculus


Alignment Length:490 Identity:115/490 - (23%)
Similarity:204/490 - (41%) Gaps:62/490 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTINLLLAVGALFWIYFLWSRRRLYFLMLKIPGPIGLPILGSSLENIITYKRKLSFRTKYLNKY 65
            :|.:.|||...|.::::..|..:.|....   |.|....:.|::|::     :.|......:.|:
Mouse    24 LLGLLLLLLKSAQYYLHRQWLIKSLQQFP---PAPPPQWLFGNTLKD-----QDLQQILLCVEKF 80

  Fly    66 GSTILTWM-GPVPFIVTRDPKVVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGKQDPHWLDRRKH 129
            .||.:.|: |....:|..||..::.|....|  .|.....:.....:|.|||......|...|:.
Mouse    81 PSTYVRWLWGNHARVVIYDPDYMKVILGRSD--PKVVRSYSFFAPWIGYGLLLLNGKKWFQHRRM 143

  Fly   130 FNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKG---------EIDVVPEMLRWSFKIAAQTTM 185
            ..|:|..|:|..:..|......|:::..:..||:.         .:..:..|::.:|     :..
Mouse   144 LTPAFHYDILKPYVGIMVDSVHVMLDKWEQLVDQDCPLEIYQDISLMTMETMMKCAF-----SYQ 203

  Fly   186 GSEVKHDEHFKNGSLVESFESLISHSTLNILMPLVQNRMISKICGYDKLRADNFSRIQKMLDNVV 250
            || |:.::...:.|.:::.|.|.....|.:.....||..|..:....:..........|..:.|:
Mouse   204 GS-VQLEDCRNSKSYIKAVEDLTHLIYLRVRNGFHQNNTIYSLSSNGRSFYHACQIAHKHTERVI 267

  Fly   251 NKKVNPLPKTDSDPESNIVINRA-MELYRKG------DITYM------------DVKSECCIMIA 296
            ..:...|.            |.| :|.:||.      ||...            ||::|....:.
Mouse   268 RMRKAQLQ------------NEAELEKFRKKKRLDFLDILLFAQTEDGKSLSDEDVRAEMDTFMF 320

  Fly   297 AGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYLERVIKETLRLI 361
            .|::|:|..:....:.||.|||||:...||:..:..:.  ..:|...:.::.|....|||.|||.
Mouse   321 EGHNTTASGISWIFYALATHPEHQQRCREEVKSILGNG--TSVTLNHLDQMPYTTMCIKEALRLY 383

  Fly   362 PAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQKHPY 426
            |.||..:||..:.|...:|..:|||.::.:..:..|.||.: .|:|:.|:|..|......|.|  
Mouse   384 PPIPGASRELSSPVTFPDGCSLPKGFLVTLSFYGLHHNPRL-RPNAEVFDPSRFAPGAPRQTH-- 445

  Fly   427 AYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKI 461
            |::||:.|.|||||.::.|...|.|:...|..:::
Mouse   446 AFLPFSAGTRNCIGKQFTMNELKVAVALTLLRFEL 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 108/458 (24%)
Cyp4a30bXP_006503285.1 p450 59..504 CDD:365848 106/452 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.