DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and Cyp12a5

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster


Alignment Length:477 Identity:109/477 - (22%)
Similarity:193/477 - (40%) Gaps:95/477 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 YGSTILT--WMGPVPFIVTRDPKVVEDIFSS-------PDCHNKSQH-------IVNAITSCMGN 113
            ||:.|..  .||....::|.:||..|.:|.:       |.......|       ..:.:     .
  Fly    85 YGNIIFLPGMMGRDGLVMTHNPKDFEVVFRNEGVWPFRPGSDILRYHRTVYRKDFFDGV-----Q 144

  Fly   114 GLLGKQDPHWLDRRKHFNP----------SFK------QDLLLSFFHIFDAET-KVLMNLLDTY- 160
            |::..|...|.|.|...||          .||      |:.:.....|.||.| :|..|.|:|. 
  Fly   145 GIIPSQGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQVNQEFVELIKEIRDASTQEVPGNFLETIN 209

  Fly   161 ------VDKGEIDVVPEMLRWSFKIAAQTTMGSEVKHDEHFKNGSLVESFESLISHSTLNILMPL 219
                  |....:|....:||.|.|.:..|.:...:  ||.|.:.:.:|...||..:....:|..:
  Fly   210 RWTLESVSVVALDKQLGLLRESGKNSEATKLFKYL--DEFFLHSADLEMKPSLWRYFKTPLLKKM 272

  Fly   220 VQNRMISKICGYDKLRADNFSRIQKMLDNVVNKKVNPLPKTDSD----PE-SNIVINRAMELYRK 279
            ::                ....:|::....|::.:..|.|...:    || ...|:.:.:::.:|
  Fly   273 LR----------------TMDSVQEVTLKYVDEAIERLEKEAKEGVVRPEHEQSVLEKLLKVDKK 321

  Fly   280 -GDITYMDVKSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPD 343
             ..:..||       |:.||.||::.|....|..||.:||.|..:.||:..|.|:... ..|...
  Fly   322 VATVMAMD-------MLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPNKDS-EFTEAS 378

  Fly   344 MQKLDYLERVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDAD 408
            |:.:.||...|||:.|:.|.:...||....|..:| |..:|.|.::.:...::..:.|.: |...
  Fly   379 MKNVPYLRACIKESQRVYPLVIGNARGLTRDSVIS-GYRVPAGTIVSMIPINSLYSEEYF-PKPT 441

  Fly   409 NFNPDNFL-----------AENMEQKHPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKI- 461
            .|.|:.:|           |.:::.|:|:.::||..|.|.|:|.:...|..:....|::||:.: 
  Fly   442 EFLPERWLRNASDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVE 506

  Fly   462 ---STSTLYKD-LVYVDNMTMK 479
               ||...::. |:.:.|:.:|
  Fly   507 FNHSTKNAFRSALINLPNIPLK 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 104/458 (23%)
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 109/477 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442740
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.