DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and CYP4F3

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:503 Identity:126/503 - (25%)
Similarity:217/503 - (43%) Gaps:79/503 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLAVGA-------LFWIYFLWSR-----------RRLYFLMLKIPGPIGLPILGSSLENIITYK 52
            |||.|||       |.|.|..:..           :|.:||     |.:||  :.||.|.:: |.
Human    21 LLLLVGASWLLARILAWTYTFYDNCCRLRCFPQPPKRNWFL-----GHLGL--IHSSEEGLL-YT 77

  Fly    53 RKLSFRTKYLNKYGSTILTWMGPVPFIV-TRDPKVVEDIFSSPDC-HNKSQHIVNAITSCMGNGL 115
            :.|:.      .:|.....|:||...|| ...|..::.:..:|.. ..|.:...:.:...:|:||
Human    78 QSLAC------TFGDMCCWWVGPWHAIVRIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGL 136

  Fly   116 LGKQDPHWLDRRKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKG--EIDVVPEMLRWSFK 178
            |......|...|:...|:|..::|..:..||:....::.........:|  .:|:        |:
Human   137 LLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDM--------FE 193

  Fly   179 IAAQTTMGSEVKHDEHFKNGSLVESFESLISHSTLNILMPLVQ-NRMISK----------ICGYD 232
            ..:..|:.|..|         .|.||:|.........:..::: :.:::|          ...|.
Human   194 HISLMTLDSLQK---------CVFSFDSHCQEKPSEYIAAILELSALVTKRHQQILLYIDFLYYL 249

  Fly   233 KLRADNFSR----IQKMLDNVVNKKVNPLPKTDSD-------PESNIVINRAMELYRKGD---IT 283
            ......|.|    :....|.|:.::...||....|       ....:.....:.|.:..|   ::
Human   250 TPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLS 314

  Fly   284 YMDVKSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLD 348
            ..|:::|....:..|:||:|..:...|:.||.|||:||...:|:..:..|.....|.:.|:.:|.
Human   315 DEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAQLP 379

  Fly   349 YLERVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPD 413
            :|...|||:|||.|.:|..:|....|:.|.:|.:||||::..|.:|.||.||.|| ||.:.::|.
Human   380 FLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIICLISVFGTHHNPAVW-PDPEVYDPF 443

  Fly   414 NFLAENMEQKHPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKI 461
            .|..:|::::.|.|:|||:.|.|||||..:||...|..|...|..:::
Human   444 RFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFRV 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 114/458 (25%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 117/472 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.