DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and Cyp12b2

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster


Alignment Length:504 Identity:117/504 - (23%)
Similarity:193/504 - (38%) Gaps:108/504 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WSRRRLYFLMLKIPGPIGLPIL-----GSSLENIITYKRKLSFRTKYLNKYGSTILTWMGPVPFI 79
            |.:.|.:.   :||||..|.:|     |.:|.|....:.....|..|.:.|  .|...||....:
  Fly    47 WQQARSFG---EIPGPSLLRMLSFFMPGGALRNTNLIQMNRLMREMYGDIY--CIPGMMGKPNAV 106

  Fly    80 VTRDPKVVEDIFSS---------------------PDCHNKSQHIVNAITSCMGNGLLGKQDPHW 123
            .|.:|...|..:.:                     ||       :...:     .||...|...|
  Fly   107 FTYNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPD-------VFKGV-----GGLASDQGQEW 159

  Fly   124 LDRRKHFNP------SFKQDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPE----------- 171
            .|.|...||      :.:|:|            ..|..:...::||.|....||           
  Fly   160 ADIRNKVNPVLMKVQNVRQNL------------PQLDQISKEFIDKLETQRNPETHTLTTDFHNQ 212

  Fly   172 MLRWSFK----IAAQTTMGSEVKHDEHFKNGS-LVESFESLISHSTLNILMPLVQNRMISKICGY 231
            :..|:|:    :|..|.||  :..|....|.. |.:......::|....:.|.:..  ..|..|:
  Fly   213 LKMWAFESISFVALNTRMG--LLSDNPDPNADRLAKHMRDFFNYSFQFDVQPSIWT--FYKTAGF 273

  Fly   232 DKLRADNFSRIQKMLDNVVNKKVNPLPKTDSDPESNIVINRAMELYRKGDIT-YMDVKSECCIMI 295
            .|. ...:..|..:..|.:...:....|.| |.::..|:.:.:|..:|..:| .||       |:
  Fly   274 KKF-LKTYDNITDITSNYIETAMRGFGKND-DGKTKCVLEQLLEHNKKVAVTMVMD-------ML 329

  Fly   296 AAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYLERVIKETLRL 360
            .||.||::......|:.||.:|..||.:..||..:.|.... .:|..:.:.:.||...|||.||:
  Fly   330 MAGIDTTSSACLTILYHLARNPSKQEKLRRELLRILPTTKD-SLTDQNTKNMPYLRACIKEGLRI 393

  Fly   361 IPAIPITARETKNDVRLSNGVLIPK--GVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENM--- 420
            ....|...|.|..|:.|| |..:|:  ||::|:...   .|.:.:...:..|.|:.:|..::   
  Fly   394 TSITPGNFRITPKDLVLS-GYQVPRGTGVLMGVLEL---SNDDKYFAQSSEFIPERWLKSDLAPD 454

  Fly   421 -------EQKHPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKIS 462
                   ..::|:.|:||..|.|.|||.:.|.:..:..|.|:||:||:|
  Fly   455 IQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVS 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 114/491 (23%)
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 112/489 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442775
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.