DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and Cyp4ac3

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster


Alignment Length:531 Identity:137/531 - (25%)
Similarity:238/531 - (44%) Gaps:80/531 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAVGALFWIYFLWSRRRLYFLM------------------LKIPGPI----GLPILGSSLENIIT 50
            |.:||| |: .|....:.||::                  ..:||..    .|.:|..:..||.:
  Fly    10 LLIGAL-WL-LLRQLNKTYFILSLCKRVRTADGSPLESKVFVVPGKTRFGNNLDLLNLTPANIFS 72

  Fly    51 YKRKLSFRTKYLNKYGSTILTWMGPVPFIVTRDPKVV-----EDIFSSPDCHNKSQHIVNAITSC 110
            |.|:.:.:....|      ..|    .|:...:..:|     |:||.|.....|:.. ...|...
  Fly    73 YIRESTAKANGQN------YIW----NFLFAPEYNIVRAEDAEEIFQSTKITTKNMS-YELIRPF 126

  Fly   111 MGNGLLGKQDPHWLDRRKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRW 175
            :|:|||...|..|..|||...|:|..::|.||..||..|:|..:.:||..|. .|:::...:.::
  Fly   127 LGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKNVG-FELELNQIIPQF 190

  Fly   176 SFKIAAQTTMGSEVKHDEHFKNG---SLVESFESLISHSTLNILMPL-----------VQNRMIS 226
            :.....:|.:|  ||.|:..:..   ..:..||.:.:....|.||..           ..:|::.
  Fly   191 TLNNICETALG--VKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYSRILR 253

  Fly   227 KICGYD----KLRADNFSRIQKMLDNV--VNKKVNPLPKTDSDPESNIVINRAMELYRKGDITYM 285
            .|.|:.    :.:...|.  ||.|..|  ..||           :...:::..:....:|.|.:.
  Fly   254 TIHGFSSGIIQRKRQQFK--QKQLGQVDEFGKK-----------QRYAMLDTLLAAEAEGKIDHQ 305

  Fly   286 DVKSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYL 350
            .:..|....:..||||::.::...|.|||.|.:.||..:|||..:..|...  ::.....:|.:|
  Fly   306 GICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDE--VSMFQFNELIHL 368

  Fly   351 ERVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNF 415
            |.||||:|||.|:.||..| |..:..:.||:::||...|.|.::...|:...: |..:.|.|:.|
  Fly   369 ECVIKESLRLFPSAPIIGR-TCIEESVMNGLVLPKNAQISIHIYDIMRDARHF-PKPNQFLPERF 431

  Fly   416 LAENMEQKHPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNMTMKL 480
            |.||...:||:|::||:.|.|||||.|:.::..|..|..::||:|:..:|..:||.:.:.:.::.
  Fly   432 LPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPATQLEDLTFENGIVLRT 496

  Fly   481 AEYPRLKLQRR 491
            .:..::|.:.|
  Fly   497 QQNIKVKFEAR 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 124/458 (27%)
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 127/483 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I1781
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
43.960

Return to query results.
Submit another query.