DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and Cyp4s3

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster


Alignment Length:512 Identity:128/512 - (25%)
Similarity:233/512 - (45%) Gaps:73/512 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 INLLLAVGALFWIYFL-WSRRRLYFLMLK-----IPGP-IGLPILGSSLENIITYKRKLSFRTKY 61
            ::.|..|..:.|..|| :..:.|.||.|:     :||| ||..|.......|:.:.::|.     
  Fly     1 MSTLALVAFVLWAAFLRYLPKILNFLRLQRFAKTLPGPTIGELIANVKKGEILNWLKELR----- 60

  Fly    62 LNKYGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGKQDPHWLDR 126
             .|:|.....|.|....::..||:.::.:..:.....||:: ...:...:|.|||......|..|
  Fly    61 -EKHGPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTKSRN-YELLEPWLGKGLLTNGGESWHRR 123

  Fly   127 RKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRWSFKIAAQTTMGSEVKH 191
            ||...|.|...:|..|....:...::|:..|.|..:....|:.|.:..::.....:|.||.: ||
  Fly   124 RKLLTPGFHFRILSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAICETAMGIK-KH 187

  Fly   192 DEHFKNGSLVESFESL--ISH-------STLNILM----PLVQNRMISKICGYDKLRADNFSRIQ 243
            .:...:...|::.:|:  :.|       ..||:..    |..:.....|:.      .|..:|:.
  Fly   188 AQLQSDSEYVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPGKEREAALKVL------HDETNRVI 246

  Fly   244 KM-LDNVVNKKVNPLPKTDSDPESNIVINRAM---------ELYRKGDITYMDVKSECCIMIAAG 298
            :: .:.::.::....|:.:.|   ::...|.:         ::....:::..|::.|....:..|
  Fly   247 RLRREQLIQERNEWKPEAEQD---DVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEG 308

  Fly   299 YDTSALTVYHALFLLANHPEHQEAVFE---ELNGVFPDAGHFGITYPDMQKLDYLERVIKETLRL 360
            :||::..:..||.||:.:|:.|:..||   ||.|            .:.:.:.|||.|||||||:
  Fly   309 HDTTSSAIAFALSLLSKNPDVQQRAFEEASELEG------------REKESMPYLEAVIKETLRI 361

  Fly   361 IPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQKHP 425
            .|::|..:|:...|:.:.. :.:|||..|...::..||:|:.: ||.:.|:||.||. |.:|.||
  Fly   362 YPSVPFFSRKVLEDLEVGK-LTVPKGASISCLIYMLHRDPKNF-PDPERFDPDRFLV-NEKQMHP 423

  Fly   426 YAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNMTMKLAE 482
            :|:..|:.|.|||||.|:||:..|.:|..:||:|:.        |...|:....|||
  Fly   424 FAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRF--------LPDKDHQPKPLAE 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 114/456 (25%)
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 116/473 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I1781
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
54.860

Return to query results.
Submit another query.