DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and Cyp318a1

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster


Alignment Length:537 Identity:122/537 - (22%)
Similarity:249/537 - (46%) Gaps:82/537 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 INLLL-AVGALFWIYFLWSRRRLYFLMLKIPGPIGL---PIL----------GSSLENIITYKRK 54
            :|:.| |.|||..:...|.:|:.:.|:.::.|..|:   |:|          .|.||.:..|  :
  Fly     3 LNIALWACGALLAVLLAWQQRKCWRLIWQLNGWRGVIQQPVLWLLLCINLHPNSILEKVSQY--R 65

  Fly    55 LSFRTKYLNKYGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGKQ 119
            :.|:.......|:.:|.::.        ||..:|.:.::|:|.:|: .:.:..  .:..|||..:
  Fly    66 VHFQRPLAVLVGTRVLLYID--------DPAGMECVLNAPECLDKT-FLQDGF--FVRRGLLHAR 119

  Fly   120 DPHWLDRRKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVD-KGE---IDVVPEML-RWSFKI 179
            ...|..|||..||:|..:::.|||.:|::....::....|..: .|:   .....::| |...::
  Fly   120 GQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEV 184

  Fly   180 AAQTTMGSEVKHDEHFKNGSLVESFESLISHSTLNILMPLVQNRMISKICG---YDKLRADNFSR 241
            :..|.||:.....: ..:..:..|::.|:..|.:.::.|.:|.|::.::..   |::.:     :
  Fly   185 SCLTIMGTPTNFTQ-LDDAHIAHSYKRLLEISAVRVVKPWLQIRLLHRLLAPELYEESK-----K 243

  Fly   242 IQKMLDNVVNKKVNPL------------PKTDSDP----ESNIVINRAMELYRKGDITYMDVKSE 290
            ..|:|::.|...|...            .|:..|.    :..|.|.:..:|...|::|..::..|
  Fly   244 CAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLAANGEMTLEEIMDE 308

  Fly   291 CCIMIAAGYDTSALTVYHALFLLA-NHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYLERVI 354
            ...|:...::|.:.::..||..|| |..:.|..:..|:..:.||.|..|:  ..:|:|.||:..:
  Fly   309 AQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQVGL--EQLQQLRYLDAFV 371

  Fly   355 KETLRLIPAIPITARETKNDVRLS---NGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFL 416
            .|:|||:..:|:..|....|.||:   :..::|:..::.:|.|:..|:...||.:|..|:|..||
  Fly   372 SESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFL 436

  Fly   417 AENMEQ-------------------KHPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKIS 462
            .:..||                   :|.|:::||:.|.|:|||.:|.:...|..|.:::.|:...
  Fly   437 DQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQ 501

  Fly   463 TSTLYKDLVYVDNMTMK 479
            :....:.|.:|:|:::|
  Fly   502 SDFELEKLQFVENISLK 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 109/489 (22%)
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 107/481 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450081
Domainoid 1 1.000 82 1.000 Domainoid score I1949
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I1605
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008559
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.