DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and Cyp4f4

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_775146.1 Gene:Cyp4f4 / 286904 RGDID:708363 Length:522 Species:Rattus norvegicus


Alignment Length:503 Identity:140/503 - (27%)
Similarity:225/503 - (44%) Gaps:79/503 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLAVGALFWI--------YFLWSRRRLYFLMLKIPGPIGLP----ILGSSLENIITYKRKLSFR 58
            |||.:|| .|:        |..:   |.|..:...|.|   |    .|| .|..|...::.|...
  Rat    21 LLLLIGA-SWLLVRVLTQTYIFY---RTYQHLCDFPQP---PKWNWFLG-HLGMITPTEQGLKQV 77

  Fly    59 TKYLNKYGSTILTWMGPV-PFIVTRDPKVVEDIFS-SPDCHNKSQHIVNAITSCMGNGLLGKQDP 121
            ||.:..|....:||:||: |.|....|.|:..:.| |.....|.....:.:...:|:|||.....
  Rat    78 TKLVATYPQGFMTWLGPILPIITLCHPDVIRSVLSASASVALKEVIFYSFLKPWLGDGLLLSDGD 142

  Fly   122 HWLDRRKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKG--EIDVVPEMLRWSFKIAAQTT 184
            .|...|:...|:|..::|..:..||:..|.::..........|  .:|:        ||..:..|
  Rat   143 KWSCHRRMLTPAFHFNILKPYVKIFNDSTNIMHAKWQDLASGGSARLDM--------FKNISLMT 199

  Fly   185 MGS------------EVKHDEHFK-----NGSLVESFESLISHSTLNILMPLVQN-RMISKICGY 231
            :.|            :.|..|:..     :..:.:.::.|:.|:  :.|..|..| |...|.|  
  Rat   200 LDSLQKCVFSFDSNCQEKPSEYISAILELSALVAKRYQQLLLHT--DSLYQLTHNGRRFHKAC-- 260

  Fly   232 DKLRADNFSRIQKMLDNVVNKKVNPLPKTDSDPESNIVINRAME---------LYRKG----DIT 283
             || ..||:      |.|:..:...||   |..|.:|:..:|..         |..|.    :::
  Rat   261 -KL-VHNFT------DAVIQGRRRALP---SQHEDDILKAKARSKTLDFIDVLLLTKDEDGKELS 314

  Fly   284 YMDVKSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLD 348
            ..|:::|....:..|:||:|..:...|:.||.|||:||...:|:..:..|.....|.:.|:.:|.
  Rat   315 DEDIRAEADTFMFEGHDTTASGLSWILYNLARHPEYQERCRQEVRELLRDRESTEIEWDDLAQLP 379

  Fly   349 YLERVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPD 413
            :|...|||:|||.|.:.:.:|....|:.|.:|.:|||||:..|::|.||.||.|| ||.:.::|.
  Rat   380 FLTMCIKESLRLHPPVTVISRRCTQDIVLPDGRVIPKGVICIINIFATHHNPTVW-PDPEVYDPF 443

  Fly   414 NFLAENMEQKHPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKI 461
            .|..||::.:.|.|:|||:.|.|||||..:||...|.||...|..:::
  Rat   444 RFDPENIKDRSPLAFIPFSAGPRNCIGQTFAMNEMKVALALTLLRFRV 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 131/468 (28%)
Cyp4f4NP_775146.1 CYP4F 74..515 CDD:410772 124/442 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.