DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and CYP4A22

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:482 Identity:116/482 - (24%)
Similarity:205/482 - (42%) Gaps:46/482 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTINLLLAVGALFWIYFLWSRRRLYFLMLKIPGPIGLPILGSSLENIITYKRKLSFRTKYLNKY 65
            :|.:.|||...|..:::..|..:.|.    :.|.|....:.|...|  ..:.::|....:.:..:
Human    24 LLILLLLLIKAAQLYLHRQWLLKALQ----QFPCPPSHWLFGHIQE--FQHDQELQRIQERVKTF 82

  Fly    66 GSTILTWM-GPVPFIVTRDPKVVEDIF--SSPDCHNKSQHIVNAITSCMGNGLLGKQDPHWLDRR 127
            .|....|: |....:...||..::.|.  |.|..|...:.:...|    |.|||......|...|
Human    83 PSACPYWIWGGKVRVQLYDPDYMKVILGRSDPKSHGSYKFLAPRI----GYGLLLLNGQTWFQHR 143

  Fly   128 KHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRWSFKIAAQTTMGSEVKHD 192
            :...|:|..|:|..:..:.....:|   :||.:.:....|...|:.:....:...|.|.|...|.
Human   144 RMLTPAFHNDILKPYVGLMADSVRV---MLDKWEELLGQDSPLEVFQHVSLMTLDTIMKSAFSHQ 205

  Fly   193 EHFKNGSLVESFESLISHSTLN-ILMPLVQNRMISKICGYDKLRADNFSRIQKMLDNVVNKKVNP 256
            ...:.....:|:...|  |.|| ::...::|........|....|..::.....|.:....:|..
Human   206 GSIQVDRNSQSYIQAI--SDLNSLVFCCMRNAFHENDTIYSLTSAGRWTHRACQLAHQHTDQVIQ 268

  Fly   257 LPKTDSDPESNIVINRAMELYRKGDITYMDV-----------------KSECCIMIAAGYDTSAL 304
            |.|.....|..:     .::.||..:.::|:                 ::|....:..|:||:|.
Human   269 LRKAQLQKEGEL-----EKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTAS 328

  Fly   305 TVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYLERVIKETLRLIPAIPITAR 369
            .:...|:.||.||:|||...||::|:..|..  .||:..:.::.|....|||.|||.|.:|...|
Human   329 GISWILYALATHPKHQERCREEIHGLLGDGA--SITWNHLDQMPYTTMCIKEALRLYPPVPGIGR 391

  Fly   370 ETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQKHPYAYIPFARG 434
            |....|...:|..:|||:::.:.::..|.||:|| |:.:.|:|..|...:.:  |.:|::||:.|
Human   392 ELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVW-PNLEVFDPSRFAPGSAQ--HSHAFLPFSGG 453

  Fly   435 KRNCIGSKYAMMSSKFALCRILRNYKI 461
            .|||||.::||...|.|....|..:::
Human   454 SRNCIGKQFAMNQLKVARALTLLRFEL 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 109/450 (24%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 109/450 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.