DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and Cyp4v3

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001129072.1 Gene:Cyp4v3 / 266761 RGDID:708530 Length:525 Species:Rattus norvegicus


Alignment Length:511 Identity:141/511 - (27%)
Similarity:238/511 - (46%) Gaps:59/511 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IYFLWSRRRLYFLMLKIPGPI-GLPILGSSL----------ENIITYKRKLSFRTKYLNKYGSTI 69
            :..|.|..|.:..|..||... ..|::|.:|          :.||.|..:.        ::...|
  Rat    34 LQMLVSYARKWQQMRPIPSVARAYPLVGHALFMKPNNTEFFQQIIQYTEEF--------RHLPII 90

  Fly    70 LTWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGKQDPHWLDRRKHFNPSF 134
            ..|:||||.:.....:.||.|.:|....:|| .:...:...:|.|||......|..|||...|||
  Rat    91 KLWIGPVPLVALYKAENVEVILTSSKQIDKS-FMYKFLQPWLGLGLLTSTGSKWRARRKMLTPSF 154

  Fly   135 KQDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRWSFKIAAQTTMGSEVKHDEHFKNGS 199
            ...:|..|..:.:.:..:|:|.|:.:|::...:....:...:..|..:|.||..:        |:
  Rat   155 HFTILEDFLDVMNEQANILVNKLEKHVNQEAFNCFFPITLCALDIICETAMGKNI--------GA 211

  Fly   200 LVESFESLISHSTLNILMPLVQNRMISKICGYD------KLRADN---FSRIQKMLDNVVNKKVN 255
            ........:  .|:..:..::..||......:|      |...|:   ...:....:||:.::||
  Rat   212 QSNGDSEYV--RTVYRMSDMIYRRMKMPWFWFDLWYLMFKEGRDHKKGLKSLHTFTNNVIAERVN 274

  Fly   256 --------------PLP-KTDSDPESNIVINRAMELYRKGDITYMDVKSECCIMIAAGYDTSALT 305
                          ||| ||......:::::...|...|  :::.|::.|....:..|:||:|..
  Rat   275 ARKAEQDCIGAGRGPLPSKTKRKAFLDLLLSVTDEEGNK--LSHEDIREEVDTFMFEGHDTTAAA 337

  Fly   306 VYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYLERVIKETLRLIPAIPITARE 370
            :..:|:||.::||.|..|.:||:.|| ...|..:|..|::||.||:.|||||||:.|::|:.||.
  Rat   338 INWSLYLLGSNPEVQRKVDKELDDVF-GRSHRPVTLEDLKKLKYLDCVIKETLRVFPSVPLFARS 401

  Fly   371 TKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQKHPYAYIPFARGK 435
            ...|..:: |..|.||....|..:..||:|..: ||.:.|.|:.|..||.:.:|||||:||:.|.
  Rat   402 LSEDCEVA-GYKISKGTEAVIIPYALHRDPRYF-PDPEEFQPERFFPENSQGRHPYAYVPFSAGP 464

  Fly   436 RNCIGSKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNMTMKLAEYPRLKLQRR 491
            |||||.|:|:|..|..|..|||.:.|.::...::|....::.::......:||:||
  Rat   465 RNCIGQKFAVMEEKTILACILREFWIESNQKREELGLAGDLILRPNNGIWIKLKRR 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 131/464 (28%)
Cyp4v3NP_001129072.1 CYP4V 76..515 CDD:410773 128/462 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.