DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and Cyp26b1

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001171184.1 Gene:Cyp26b1 / 232174 MGIID:2176159 Length:512 Species:Mus musculus


Alignment Length:518 Identity:120/518 - (23%)
Similarity:205/518 - (39%) Gaps:90/518 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTINLLLAVGALFWIYFLWSRRRLYFLMLKIP-GPIGLPILGSSLENIITYKRKLSFRTKYLNK 64
            ::::.|||||....| ...|:..|.....|.|| |.:|.|::|.:...::   :...|::....|
Mouse    19 LVSVTLLLAVSQQLW-QLRWAATRDKSCKLPIPKGSMGFPLIGETGHWLL---QGSGFQSSRREK 79

  Fly    65 YGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHN-------KSQHIV---NAITSCMGNGLLGKQ 119
            ||:...|.:...|.|.....:.|..|....  |.       :|..::   |.:.:.:|       
Mouse    80 YGNVFKTHLLGRPLIRVTGAENVRKILLGE--HQLVSTEWPRSARVLLGPNTVANSIG------- 135

  Fly   120 DPHWLDRRKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDT---YVDKGE-IDVVPEMLRWSFKIA 180
            |.| .::||.|:..|..:.|.|:.      .|:.:.:.||   :..:.| |:|..|..|.:|::|
Mouse   136 DIH-RNKRKVFSKIFSHEALESYL------PKIQLVIQDTLRAWSSQPEAINVYQEAQRLTFRMA 193

  Fly   181 AQTTMGSEVKHDEHFKNGSLVESFESLISH-STLNILMPL------VQNRMISKICGYDKLRADN 238
            .:..:|..:..::   .|.|.|.::..:.: .:|.:.:|.      :|.|.|             
Mouse   194 VRVLLGFSIPEED---LGHLFEVYQQFVENVFSLPVDLPFSGYRRGIQARQI------------- 242

  Fly   239 FSRIQKMLDNVVNKKVNPLPKTDSDPESNIVINRAMELYRKGDITYMDVKSECCIMIAAGYDTSA 303
               :||.|:..:.:|:......|.....:|:|..:.|  ...::|..::|.....:|.|.|.|:|
Mouse   243 ---LQKGLEKAIREKLQCTQGKDYSDALDILIESSKE--HGKEMTMQELKDGTLELIFAAYATTA 302

  Fly   304 LTVYHALFLLANHPEHQEAVFEEL-------NGVFPDAGHFGITYPDMQKLDYLERVIKETLRLI 361
            ......:..|..||...|.:.|||       .|..|..|  .:....:..|.||:.||||.:||.
Mouse   303 SASTSLIMQLLKHPAVLEKLREELRAQGLLHGGGCPCEG--TLRLDTLSSLRYLDCVIKEVMRLF 365

  Fly   362 PAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQKH-P 425
            ..:....|.......| :|..||||..:...:..||....|: .|.:.|:||.|.....|.|. .
Mouse   366 TPVSGGYRTVLQTFEL-DGFQIPKGWSVMYSIRDTHDTAPVF-KDVNVFDPDRFSQARSEDKDGR 428

  Fly   426 YAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNMTMKLAEYPRLKL 488
            :.|:||..|.|.|:|...|               |:....|..:|.......:....:||:.|
Mouse   429 FHYLPFGGGVRTCLGKHLA---------------KLFLKVLAVELASTSRFELATRTFPRITL 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 105/459 (23%)
Cyp26b1NP_001171184.1 CYP26B1 60..490 CDD:410730 106/476 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4824
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.