DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a1 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus


Alignment Length:498 Identity:125/498 - (25%)
Similarity:213/498 - (42%) Gaps:90/498 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLAVGALFWIYFLWSRRRLYFLMLKIPGPIGLPILGSSLE--------NIITYKRKLSFRTKYL 62
            ::|.|..|..:..|:.|::|...:...|||....:.|.:||        .::|:..:..:...  
Mouse    20 VILMVTVLKLLSLLFRRQKLARALDSFPGPPKHWLFGHALEIQKTGGLDKVVTWTEQFPYAHP-- 82

  Fly    63 NKYGSTILTWMGP-VPFIVTRDPKVVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGKQDPHWLDR 126
                    .|:|. :.|:...:|...:.::|..|  .|:.::.:.....:|.|||..:.|.|...
Mouse    83 --------LWLGQFIVFLNIYEPDYAKAVYSRGD--PKAAYVYDFFLQWIGKGLLVLEGPKWFQH 137

  Fly   127 RKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKG----EIDVVPEMLRWSFKIAAQTTMG- 186
            ||...|.|..|:|..:..||...|:|   :||.:..|.    ..|:..::...:.....:.|.| 
Mouse   138 RKLLTPGFHYDVLKPYVAIFAESTRV---MLDKWEKKASENKSFDIFCDVGHMALDTLMKCTFGK 199

  Fly   187 --SEVKHDEHFKNGSLVESFESLISHSTLNILMPLVQNRMIS-------------------KICG 230
              |.:.|.::        |:...:|..||     |:|.|:.|                   :.|.
Mouse   200 GDSGLSHSDN--------SYYLAVSDLTL-----LMQQRIDSFQYHNDFIYWLTPHGRRFLRACQ 251

  Fly   231 YDKLRADNFSRIQK--MLDNVVNKKVNPLPKTD-------SDPESNIVINRAMELYRKGDITYMD 286
            ......|:..|.:|  :.|....||:......|       :..||.|.::.|            |
Mouse   252 IAHDHTDHVIRQRKAALQDEKEQKKLQERRHLDFLDILLGARDESGIKLSDA------------D 304

  Fly   287 VKSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYLE 351
            :::|....:..|:||:...:...|:.:|.:|.||:...||:..:..|...|  .:.|:.::.||.
Mouse   305 LRAEVDTFMFEGHDTTTSGISWFLYCMALYPMHQQRCREEVREILGDRDSF--QWDDLAQMTYLT 367

  Fly   352 RVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFL 416
            ..:||..||.|.:|...|:....|...:|..:|.|.:|.:.::..|||..|| ||.:.|:|..|.
Mouse   368 MCMKECFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISLHIYALHRNSAVW-PDPEVFDPLRFS 431

  Fly   417 AENMEQKHPYAYIPFARGKRNCIGSKYAMMSSKF--ALCRILR 457
            .|||..:||:|::||:.|.|||||.::||...|.  ||| :||
Mouse   432 PENMTGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALC-LLR 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 119/471 (25%)
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 119/471 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.