DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8461 and AT1G12650

DIOPT Version :9

Sequence 1:NP_650367.1 Gene:CG8461 / 41758 FlyBaseID:FBgn0038235 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001031031.1 Gene:AT1G12650 / 837821 AraportID:AT1G12650 Length:248 Species:Arabidopsis thaliana


Alignment Length:246 Identity:82/246 - (33%)
Similarity:130/246 - (52%) Gaps:33/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSPSESSSASEHEASDDNETQNAIREDLKGMSFEEIMKLKEELGAKVYKEAVLGSKSSRPQKPK- 65
            |...|..|.|...:||:.|      |..|.::||||.||:.:           |||:. |.||. 
plant    19 SEEDEDLSCSSVSSSDEEE------ETEKELTFEEIHKLRAD-----------GSKAV-PWKPNQ 65

  Fly    66 -AKTDLKRLNKNRPREMTTRRQVPFLGAEHRVERKKNVELRDPRFDEKSGTYSAETFKKNYQFVS 129
             .||...|.|||||.|:::::.|........|.:|   |:|||||::..||...|.|:|.|.|..
plant    66 VKKTGRARANKNRPMEVSSKKPVSRYREVVHVPKK---EVRDPRFNQLGGTLDVEGFRKRYNFFF 127

  Fly   130 QIRAK-EVGQLKKKLDEVEDEAEKHHIKDTM---QRLI--NKNVEDKKWHTKQKQLKKERSAIQK 188
            :.:.. |..:|||||.:.::..|...:|:.:   ::::  ..:.::|......:..||||.|.::
plant   128 EDKLPVEREELKKKLKKTKNPEEIDELKNQLTYVEKMLKYEPSTQNKGAAILTEHKKKEREAAKE 192

  Fly   189 KHDLGQQPHYLTKKERRAKELVAQFEKLKNTGKLNKHMEKRRKKNAAKDRK 239
                |::|:||.|.|.|.:.|:.::..||.:|||..:::|||||||.||.:
plant   193 ----GKRPYYLKKSEIRKQTLIEKYNSLKESGKLTSYLDKRRKKNATKDHR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8461NP_650367.1 DUF947 72..232 CDD:283706 53/165 (32%)
AT1G12650NP_001031031.1 RRP36 73..232 CDD:399240 53/165 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 96 1.000 Domainoid score I2478
eggNOG 1 0.900 - - E1_KOG3190
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40346
Inparanoid 1 1.050 110 1.000 Inparanoid score I2064
OMA 1 1.010 - - QHG55080
OrthoDB 1 1.010 - - D1471490at2759
OrthoFinder 1 1.000 - - FOG0005843
OrthoInspector 1 1.000 - - oto3446
orthoMCL 1 0.900 - - OOG6_103080
Panther 1 1.100 - - LDO PTHR21738
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.