DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8461 and Rrp36

DIOPT Version :9

Sequence 1:NP_650367.1 Gene:CG8461 / 41758 FlyBaseID:FBgn0038235 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_659106.2 Gene:Rrp36 / 224823 MGIID:2385053 Length:244 Species:Mus musculus


Alignment Length:249 Identity:82/249 - (32%)
Similarity:141/249 - (56%) Gaps:25/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SPSESSSASEHEASDDNE-TQNAIREDLKGMSFEEIMKLKEELGAKVYKEAVLG--SKSSRPQKP 64
            |.:.:.:...|.|.:..| |.:.::.|...|||||:::|:.:...|.:|:.|.|  :::..||:|
Mouse     6 SRARAEAEGPHRAMEGGEVTGDRLKADTSDMSFEELLRLQGQGRPKAHKQLVAGNSTRTRSPQQP 70

  Fly    65 KAKTDLKRLNKNRPREMTTRRQVPFLGAEHRVERKKNVELRDPRFDEKSGTYSAETFKKNYQFVS 129
            ....|     |:||.||:.:.:||||.....:.:|   ..||||||:.||.|:.|.|.|.|||::
Mouse    71 VCVAD-----KHRPLEMSAKVRVPFLRQVVPISKK---VARDPRFDDLSGDYNPEVFDKTYQFLN 127

  Fly   130 QIRAKEVGQLKKKLDEVEDEAEKHHIKDTMQRLINKNVEDKKWHTKQKQ-------LKKERSAIQ 187
            .|||||...:||:|.: ....|:|   |.:|:|:.:..:.:....::||       ||:||.|..
Mouse   128 DIRAKEKQLVKKQLKK-HRSGEEH---DKLQQLLQRMEQQEMAQQERKQQQELRLALKQERRAQA 188

  Fly   188 KKHDLGQQPHYLTKKERRAKELVAQFEKLKNTGKLNKHMEKRRKKNAAKDRKRI 241
            ::   |.:|::|.|.|:|...|..:|::|:.:.||...:.::|::||.|||:.:
Mouse   189 QQ---GHRPYFLKKSEQRQLALAEKFKELRRSKKLESFLSRKRRRNAGKDRRHL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8461NP_650367.1 DUF947 72..232 CDD:283706 57/166 (34%)
Rrp36NP_659106.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..74 19/67 (28%)
RRP36 76..230 CDD:336301 57/163 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..244 8/21 (38%)
Nuclear localization signal. /evidence=ECO:0000255 226..229 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850048
Domainoid 1 1.000 105 1.000 Domainoid score I6653
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40346
Inparanoid 1 1.050 128 1.000 Inparanoid score I4648
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55080
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005843
OrthoInspector 1 1.000 - - oto93763
orthoMCL 1 0.900 - - OOG6_103080
Panther 1 1.100 - - LDO PTHR21738
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1216
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.