DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL11 and RPL12B

DIOPT Version :9

Sequence 1:NP_524351.1 Gene:mRpL11 / 41757 FlyBaseID:FBgn0038234 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_010706.3 Gene:RPL12B / 852026 SGDID:S000002826 Length:165 Species:Saccharomyces cerevisiae


Alignment Length:144 Identity:29/144 - (20%)
Similarity:55/144 - (38%) Gaps:45/144 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AAAGPPLGPM-LGQRAI--NIAAFCKDFNA--KTAEMK--------EGVPLPCRISVNS------ 78
            ||..|.:||: |..:.:  :||...|:|..  .|.::|        ..||....:.:.:      
Yeast    26 AALAPKIGPLGLSPKKVGEDIAKATKEFKGIKVTVQLKIQNRQAAASVVPSASSLVITALKEPPR 90

  Fly    79 DRSYDLAIHHPPATFFLKQAAGIQRGTMTPGKEVAGMITLKHLYEIAAIKIQDPPNVLLTMQQMC 143
            ||..|..:.|                        :|.|.|..:.|||. :::| .:...|:..:.
Yeast    91 DRKKDKNVKH------------------------SGNIQLDEIIEIAR-QMRD-KSFGRTLASVT 129

  Fly   144 EMLISIARTCGIKV 157
            :.::..|::.|.:|
Yeast   130 KEILGTAQSVGCRV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL11NP_524351.1 RL11 24..158 CDD:197819 29/144 (20%)
Ribosomal_L11 24..157 CDD:100101 28/142 (20%)
RPL12BNP_010706.3 PLN03072 1..165 CDD:178621 29/144 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0080
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.