DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL11 and PRPL11

DIOPT Version :9

Sequence 1:NP_524351.1 Gene:mRpL11 / 41757 FlyBaseID:FBgn0038234 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_174575.1 Gene:PRPL11 / 840194 AraportID:AT1G32990 Length:222 Species:Arabidopsis thaliana


Alignment Length:175 Identity:61/175 - (34%)
Similarity:92/175 - (52%) Gaps:20/175 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KAAGKLKSLKKTVERVTHTSKLKTNIPAGMAAAGPPLGPMLGQRAINIAAFCKDFNAKTAEMKEG 67
            |..||.|.:         ...:|..:.||.|...||:||.||.:.:||.|||||:||:||: |.|
plant    66 KPGGKAKKV---------VGVIKLALEAGKATPAPPVGPALGSKGVNIMAFCKDYNARTAD-KAG 120

  Fly    68 VPLPCRISVNSDRSYDLAIHHPPATFFLKQAAGIQRGTMTPGKEVAGMITLKHLYEIAAIKIQDP 132
            ..:|..|:|..|:|:...:..|||:..|.:|||:::|:..|.::..|:||:..|..|||.|:  |
plant   121 YIIPVEITVFDDKSFTFILKTPPASVLLLKAAGVEKGSKDPQQDKVGVITIDQLRTIAAEKL--P 183

  Fly   133 PNVLLTMQQMCEMLISIARTCGIKVVREIDPAAYGEFLEERKLIV 177
            .....|::....::...|...||    :|||    ..||.:|..|
plant   184 DLNCTTIESAMRIIAGTAANMGI----DIDP----PILEPKKKAV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL11NP_524351.1 RL11 24..158 CDD:197819 50/133 (38%)
Ribosomal_L11 24..157 CDD:100101 50/132 (38%)
PRPL11NP_174575.1 rplK 71..208 CDD:234661 51/152 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I3823
eggNOG 1 0.900 - - E1_COG0080
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1346532at2759
OrthoFinder 1 1.000 - - FOG0002852
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100842
Panther 1 1.100 - - O PTHR11661
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1892
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.