DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL11 and MRPL11

DIOPT Version :9

Sequence 1:NP_524351.1 Gene:mRpL11 / 41757 FlyBaseID:FBgn0038234 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001329916.1 Gene:MRPL11 / 829701 AraportID:AT4G35490 Length:155 Species:Arabidopsis thaliana


Alignment Length:159 Identity:53/159 - (33%)
Similarity:96/159 - (60%) Gaps:5/159 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AAGKLKSLKKTVERVTHTSKLKTNIPAGMAAAGPPLGPMLGQRAINIAAFCKDFNAKTAEMKEGV 68
            ||...:.|::.|     .:.::..:|||.|...||:||.|||..:|:.||||||||:|.:.|...
plant     2 AAAAKEILRRPV-----AATIRLTVPAGGARPAPPVGPALGQYRLNLMAFCKDFNARTQKYKPDT 61

  Fly    69 PLPCRISVNSDRSYDLAIHHPPATFFLKQAAGIQRGTMTPGKEVAGMITLKHLYEIAAIKIQDPP 133
            |:...|:...|.|::..:..|..::::|:|||:.:|:..||......::::|:||||.:|..||.
plant    62 PMAVTITAFKDNSFEFTVKSPTVSWYIKKAAGVDKGSTRPGHLSVTTLSVRHVYEIAKVKQTDPF 126

  Fly   134 NVLLTMQQMCEMLISIARTCGIKVVREID 162
            ...:.::.:|:.:|..|.:.|||:|::::
plant   127 CQYMPLESICKSIIGTANSMGIKIVQDLE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL11NP_524351.1 RL11 24..158 CDD:197819 48/133 (36%)
Ribosomal_L11 24..157 CDD:100101 47/132 (36%)
MRPL11NP_001329916.1 L11_bact 11..151 CDD:233500 49/144 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I3823
eggNOG 1 0.900 - - E1_COG0080
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6768
Inparanoid 1 1.050 117 1.000 Inparanoid score I2013
OMA 1 1.010 - - QHG57720
OrthoDB 1 1.010 - - D1346532at2759
OrthoFinder 1 1.000 - - FOG0002852
OrthoInspector 1 1.000 - - oto2935
orthoMCL 1 0.900 - - OOG6_100842
Panther 1 1.100 - - LDO PTHR11661
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1892
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.