DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL11 and MRPL11

DIOPT Version :9

Sequence 1:NP_524351.1 Gene:mRpL11 / 41757 FlyBaseID:FBgn0038234 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_057134.1 Gene:MRPL11 / 65003 HGNCID:14042 Length:192 Species:Homo sapiens


Alignment Length:194 Identity:80/194 - (41%)
Similarity:121/194 - (62%) Gaps:9/194 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKAAGKLKSLKK-TVERVTHTSKLKTNIPAGMAAAGPPLGPMLGQRAINIAAFCKDFNAKTAEM 64
            |||.....:.|:| .|..|     ::..:.||:|..||||||:||||.::|..|||:||.:|.::
Human     1 MSKLGRAARGLRKPEVGGV-----IRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDI 60

  Fly    65 KEGVPLPCRISVNSDRSYDLAIHHPPATFFLKQAAGIQRGTMTPGKEVAGMITLKHLYEIAAIKI 129
            |||:|||.:|.|..||::::.|..|..::|||.||||::|....||||||::||||:||||.||.
Human    61 KEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKA 125

  Fly   130 QDPPNVL--LTMQQMCEMLISIARTCGIKVVREIDPAAYGEFLEERKL-IVEQQRRELQEKREA 190
            ||....|  :.:..:...:|..||:.||:||:::.......|.:||.: :..|:..:|..:.||
Human   126 QDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERAIFLAAQKEADLAAQEEA 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL11NP_524351.1 RL11 24..158 CDD:197819 64/135 (47%)
Ribosomal_L11 24..157 CDD:100101 64/134 (48%)
MRPL11NP_057134.1 Ribosomal_L11 20..155 CDD:100101 64/134 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147650
Domainoid 1 1.000 74 1.000 Domainoid score I9207
eggNOG 1 0.900 - - E1_COG0080
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6768
Inparanoid 1 1.050 149 1.000 Inparanoid score I4395
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57720
OrthoDB 1 1.010 - - D1346532at2759
OrthoFinder 1 1.000 - - FOG0002852
OrthoInspector 1 1.000 - - oto89931
orthoMCL 1 0.900 - - OOG6_100842
Panther 1 1.100 - - LDO PTHR11661
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1155
SonicParanoid 1 1.000 - - X1892
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.