DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL11 and mrpl11

DIOPT Version :9

Sequence 1:NP_524351.1 Gene:mRpL11 / 41757 FlyBaseID:FBgn0038234 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001016785.1 Gene:mrpl11 / 549539 XenbaseID:XB-GENE-1007374 Length:192 Species:Xenopus tropicalis


Alignment Length:180 Identity:83/180 - (46%)
Similarity:124/180 - (68%) Gaps:6/180 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKAAGKLKSLKKTVERVTHTSKLKTNIPAGMAAAGPPLGPMLGQRAINIAAFCKDFNAKTAEMK 65
            ||||:..:    |||::......::..:.||.||.||||||:||||.|.|..|||:||.||.::|
 Frog     1 MSKASRAV----KTVKKANVAGMIRALVRAGQAAPGPPLGPILGQRGIPIGQFCKEFNEKTKDIK 61

  Fly    66 EGVPLPCRISVNSDRSYDLAIHHPPATFFLKQAAGIQRGTMTPGKEVAGMITLKHLYEIAAIKIQ 130
            ||:|||.:|.|..||:||:.|..||.::|||.||||::|....|.|:|||:|||.|||||.:|.|
 Frog    62 EGIPLPVKIFVKPDRTYDMKIGQPPVSYFLKAAAGIEKGAAQTGHEIAGMVTLKQLYEIALVKSQ 126

  Fly   131 DPPNVL--LTMQQMCEMLISIARTCGIKVVREIDPAAYGEFLEERKLIVE 178
            |...::  :.::.:.:.::..|::.|||||:::....||:|||||:|:::
 Frog   127 DEAFIMRDMPLRDVVKCIMGSAKSLGIKVVKDLTAEEYGKFLEERRLVLQ 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL11NP_524351.1 RL11 24..158 CDD:197819 66/135 (49%)
Ribosomal_L11 24..157 CDD:100101 65/134 (49%)
mrpl11NP_001016785.1 Ribosomal_L11 20..155 CDD:100101 65/134 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8779
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6768
Inparanoid 1 1.050 169 1.000 Inparanoid score I4016
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1346532at2759
OrthoFinder 1 1.000 - - FOG0002852
OrthoInspector 1 1.000 - - oto103741
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1155
SonicParanoid 1 1.000 - - X1892
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.