DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL11 and RpL12

DIOPT Version :9

Sequence 1:NP_524351.1 Gene:mRpL11 / 41757 FlyBaseID:FBgn0038234 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_524819.1 Gene:RpL12 / 45329 FlyBaseID:FBgn0034968 Length:165 Species:Drosophila melanogaster


Alignment Length:133 Identity:25/133 - (18%)
Similarity:56/133 - (42%) Gaps:15/133 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GMAAAGPPLGPMLGQRAINIAAFCKDFNAKTAEMKEGVPLPCRISVNSDRSYDLAIHHPPATFFL 95
            |...|...|.|.:|...::......|....|::.| |:.:...:::.:.::   ||...|:.   
  Fly    20 GEVGATSSLAPKIGPLGLSPKKIGDDIAKATSDWK-GLKITVCLTIQNRQA---AISVVPSA--- 77

  Fly    96 KQAAGIQRGTMTPGKEVAGMITLKH-----LYEIAAI-KIQDPPNVLLTMQQMCEMLISIARTCG 154
              |:.|.:....|.::......:||     ..:|.|| ::..|.::...::..|:.::..|::.|
  Fly    78 --ASLIIKALKEPPRDRKKQKNIKHSGNIGFEDILAIARVMRPRSMARELKGTCKEVLGTAQSVG 140

  Fly   155 IKV 157
            ..|
  Fly   141 CTV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL11NP_524351.1 RL11 24..158 CDD:197819 25/133 (19%)
Ribosomal_L11 24..157 CDD:100101 24/131 (18%)
RpL12NP_524819.1 PLN03072 1..165 CDD:178621 25/133 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462132
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0080
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11661
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.