DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL11 and mrpl11

DIOPT Version :9

Sequence 1:NP_524351.1 Gene:mRpL11 / 41757 FlyBaseID:FBgn0038234 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001002556.1 Gene:mrpl11 / 436829 ZFINID:ZDB-GENE-040718-294 Length:196 Species:Danio rerio


Alignment Length:183 Identity:88/183 - (48%)
Similarity:125/183 - (68%) Gaps:8/183 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKAAGKLKSLKKTVERVTHTSKL-KTNIPAGMAAAGPPLGPMLGQRAINIAAFCKDFNAKTAEM 64
            |||.:...|::||     :.|..| :..:.:|.||.||||||:|||:.|.|.|||||||.:|.::
Zfish     1 MSKISKAAKAVKK-----SDTGGLIRAIVRSGQAAPGPPLGPILGQKGIPIGAFCKDFNERTKDL 60

  Fly    65 KEGVPLPCRISVNSDRSYDLAIHHPPATFFLKQAAGIQRGTMTPGKEVAGMITLKHLYEIAAIKI 129
            |||:|||.:|:|..||:|||.|..|..::||||||||::|....|.|:|||:|::.:||||.:|.
Zfish    61 KEGIPLPVKINVKPDRTYDLKIGQPTVSYFLKQAAGIEKGAGKTGHEIAGMVTVRAVYEIARVKS 125

  Fly   130 QDPPNVL--LTMQQMCEMLISIARTCGIKVVREIDPAAYGEFLEERKLIVEQQ 180
            ||....|  .|||.:.:.:|..||:.||:||.::.|..|||||.||::|::.|
Zfish   126 QDECFKLRDTTMQNVVKSIIGSARSLGIQVVNDLSPEEYGEFLREREVILKAQ 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL11NP_524351.1 RL11 24..158 CDD:197819 69/136 (51%)
Ribosomal_L11 24..157 CDD:100101 69/135 (51%)
mrpl11NP_001002556.1 RL11 20..156 CDD:197819 68/135 (50%)
Ribosomal_L11 20..155 CDD:100101 68/134 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581473
Domainoid 1 1.000 79 1.000 Domainoid score I8637
eggNOG 1 0.900 - - E1_COG0080
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6768
Inparanoid 1 1.050 170 1.000 Inparanoid score I4113
OMA 1 1.010 - - QHG57720
OrthoDB 1 1.010 - - D1346532at2759
OrthoFinder 1 1.000 - - FOG0002852
OrthoInspector 1 1.000 - - oto39732
orthoMCL 1 0.900 - - OOG6_100842
Panther 1 1.100 - - LDO PTHR11661
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1155
SonicParanoid 1 1.000 - - X1892
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.