DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL11 and rpl12

DIOPT Version :9

Sequence 1:NP_524351.1 Gene:mRpL11 / 41757 FlyBaseID:FBgn0038234 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_963878.4 Gene:rpl12 / 327089 ZFINID:ZDB-GENE-030131-5297 Length:165 Species:Danio rerio


Alignment Length:121 Identity:25/121 - (20%)
Similarity:49/121 - (40%) Gaps:17/121 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GMAAAGPPLGPMLGQRAINIAAFCKDFNAKTAEMKEGVPLPCRISVNSDRSYDLAIHHPPATFFL 95
            |...|...|.|.:|...::......|....|.:.| |:.:..::::.:.::   ||...|:.   
Zfish    20 GEVGATSSLAPKIGPLGLSPKKVGDDIAKATGDWK-GLRITVKLTIQNRQA---AIEVVPSA--- 77

  Fly    96 KQAAGIQRGTMTPGKEVAGMITLKHLYEIAAIKIQDPPNVLLTMQQMCEMLISIAR 151
              :|.|.:....|.::...:..:||...:|..:|   .|:...|:..     ||||
Zfish    78 --SALIIKALKEPPRDRKKVKNIKHSGSVAFDEI---VNIARVMRHR-----SIAR 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL11NP_524351.1 RL11 24..158 CDD:197819 25/121 (21%)
Ribosomal_L11 24..157 CDD:100101 25/121 (21%)
rpl12NP_963878.4 PLN03072 1..165 CDD:178621 25/121 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0080
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.