DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL11 and mrpl11

DIOPT Version :9

Sequence 1:NP_524351.1 Gene:mRpL11 / 41757 FlyBaseID:FBgn0038234 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001006974.2 Gene:mrpl11 / 293666 RGDID:1359665 Length:192 Species:Rattus norvegicus


Alignment Length:187 Identity:73/187 - (39%)
Similarity:120/187 - (64%) Gaps:3/187 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLKSLKKTVERVTHTSKLKTNIPAGMAAAGPPLGPMLGQRAINIAAFCKDFNAKTAEMKEGVPLP 71
            ||..:.:|:::......:::.:.||.|..||||||:||||.::|..|||:||.||.::|||:|||
  Rat     3 KLSRVTRTLKKPEAGGVIRSIVRAGQAIPGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLP 67

  Fly    72 CRISVNSDRSYDLAIHHPPATFFLKQAAGIQRGTMTPGKEVAGMITLKHLYEIAAIKIQDPPNVL 136
            .:|.:..||:::|.|..|..::|||.||||::|....||||||:::|||:||||.:|.:|....:
  Rat    68 TKIFIKPDRTFELKIGQPTISYFLKAAAGIEKGARQTGKEVAGLVSLKHVYEIARVKAKDEAFAM 132

  Fly   137 --LTMQQMCEMLISIARTCGIKVVREIDPAAYGEFLEERKL-IVEQQRRELQEKREA 190
              :.:..:...:|..||:.||:||:::.......|.:||.: :..|:..:|..:.||
  Rat   133 QDVPLSSIVRSIIGSARSLGIRVVKDLSVDELAAFQKERAVFLAAQKEADLAAQAEA 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL11NP_524351.1 RL11 24..158 CDD:197819 61/135 (45%)
Ribosomal_L11 24..157 CDD:100101 61/134 (46%)
mrpl11NP_001006974.2 RL11 20..156 CDD:197819 61/135 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341472
Domainoid 1 1.000 74 1.000 Domainoid score I9004
eggNOG 1 0.900 - - E1_COG0080
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6768
Inparanoid 1 1.050 152 1.000 Inparanoid score I4274
OMA 1 1.010 - - QHG57720
OrthoDB 1 1.010 - - D1346532at2759
OrthoFinder 1 1.000 - - FOG0002852
OrthoInspector 1 1.000 - - oto97047
orthoMCL 1 0.900 - - OOG6_100842
Panther 1 1.100 - - LDO PTHR11661
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1892
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.