DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL11 and mrpl19

DIOPT Version :9

Sequence 1:NP_524351.1 Gene:mRpL11 / 41757 FlyBaseID:FBgn0038234 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_594095.1 Gene:mrpl19 / 2541549 PomBaseID:SPAC1486.07c Length:144 Species:Schizosaccharomyces pombe


Alignment Length:140 Identity:52/140 - (37%)
Similarity:87/140 - (62%) Gaps:0/140 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 THTSKLKTNIPAGMAAAGPPLGPMLGQRAINIAAFCKDFNAKTAEMKEGVPLPCRISVNSDRSYD 83
            |.|:.:|..:|||.|...||:||.||.|.:....|||:|||:||......|:||:|:|...|::.
pombe     4 TRTTIIKLIVPAGKATPTPPIGPALGARGLKSIDFCKEFNARTAGWMPNTPVPCKITVTPQRTFT 68

  Fly    84 LAIHHPPATFFLKQAAGIQRGTMTPGKEVAGMITLKHLYEIAAIKIQDPPNVLLTMQQMCEMLIS 148
            ..||.||.::.:.:...:::|:.:|..::.|.::|||:||||.:|..||....:.:..:|:.:|.
pombe    69 FTIHTPPTSWLISKTLDLEKGSSSPLHDIKGQLSLKHIYEIAKLKSTDPSLQGIELLSLCKSVIG 133

  Fly   149 IARTCGIKVV 158
            .|::.|:|||
pombe   134 TAKSMGVKVV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL11NP_524351.1 RL11 24..158 CDD:197819 48/133 (36%)
Ribosomal_L11 24..157 CDD:100101 47/132 (36%)
mrpl19NP_594095.1 RplK 6..144 CDD:223158 51/138 (37%)
Ribosomal_L11 9..142 CDD:100101 47/132 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I2922
eggNOG 1 0.900 - - E1_COG0080
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6768
Inparanoid 1 1.050 120 1.000 Inparanoid score I1499
OMA 1 1.010 - - QHG57720
OrthoFinder 1 1.000 - - FOG0002852
OrthoInspector 1 1.000 - - oto101226
orthoMCL 1 0.900 - - OOG6_100842
Panther 1 1.100 - - LDO PTHR11661
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1155
SonicParanoid 1 1.000 - - X1892
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.