DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL11 and mrpl-11

DIOPT Version :9

Sequence 1:NP_524351.1 Gene:mRpL11 / 41757 FlyBaseID:FBgn0038234 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_498923.1 Gene:mrpl-11 / 181917 WormBaseID:WBGene00015133 Length:195 Species:Caenorhabditis elegans


Alignment Length:195 Identity:98/195 - (50%)
Similarity:130/195 - (66%) Gaps:4/195 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKAAGKLKSLKKTVERVTHTSKLKTNIPAGMAAAGPPLGPMLGQRAINIAAFCKDFNAKTAEMKE 66
            ||.|.:::  ||.:.:|.|.:.|:|||.|.||:|.|||||.||||.:|:|.|||:||.:|...|:
 Worm     3 SKGAARVR--KKEIVKVVHGALLRTNIKAQMASAAPPLGPQLGQRGLNVANFCKEFNKETGHFKQ 65

  Fly    67 GVPLPCRISVNSDRSYDLAIHHPPATFFLKQAAGIQRGTMTPGKEVAGMITLKHLYEIAAIKIQD 131
            |||||.||:|..||:|||.|..|..|:.|||||||.||..:. .|:.|.:|:|||||||.||.:|
 Worm    66 GVPLPTRITVKPDRTYDLEICTPTTTWLLKQAAGIGRGKASK-DEIVGKLTVKHLYEIAKIKSRD 129

  Fly   132 PPNVLLTMQQMCEMLISIARTCGIKV-VREIDPAAYGEFLEERKLIVEQQRRELQEKREAKMLRT 195
            .....:.::|:|.|||...||.||.| ..::||....|||..||..|:.|.::|.:|:.||||||
 Worm   130 KALQHVPLEQICRMLIKTCRTLGIDVQYHDLDPVELKEFLVARKEKVDAQLKDLADKKAAKMLRT 194

  Fly   196  195
             Worm   195  194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL11NP_524351.1 RL11 24..158 CDD:197819 74/134 (55%)
Ribosomal_L11 24..157 CDD:100101 73/132 (55%)
mrpl-11NP_498923.1 Ribosomal_L11 23..155 CDD:100101 73/132 (55%)
RL11 23..155 CDD:197819 73/132 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159647
Domainoid 1 1.000 84 1.000 Domainoid score I5319
eggNOG 1 0.900 - - E1_COG0080
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6768
Inparanoid 1 1.050 181 1.000 Inparanoid score I2662
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57720
OrthoDB 1 1.010 - - D1346532at2759
OrthoFinder 1 1.000 - - FOG0002852
OrthoInspector 1 1.000 - - oto17464
orthoMCL 1 0.900 - - OOG6_100842
Panther 1 1.100 - - LDO PTHR11661
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1155
SonicParanoid 1 1.000 - - X1892
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.