DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and NAS2

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_012259.3 Gene:NAS2 / 854810 SGDID:S000001269 Length:220 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:39/209 - (18%)
Similarity:76/209 - (36%) Gaps:48/209 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 SSTQRASQ-------ELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAI 293
            |.|.|.||       ||.:...||. .|.:|..:.         |:.:.||::|..||.......
Yeast    18 SLTSRISQIDSFKLSELMVLKTDIE-TQLEAYFSV---------LEQQGIGMDSALVTPDGYPRS 72

  Fly   294 PIDYVKVFLERAAEKRKKGSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSN-------- 350
            .:|.::|.:.|......|..             :..|.....:|......:.|:.||        
Yeast    73 DVDVLQVTMIRKNVNMLKND-------------LNHLLQRSHVLLNQHFDNMNVKSNQDARRNND 124

  Fly   351 ---LTHGV---LVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYD----ALADNSKTLDIV 405
               :.:.:   .:.:|:.|||:....::..|.:..|......|.|.:.:    .:.:..:.|.::
Yeast   125 DQAIQYTIPFAFISEVVPGSPSDKADIKVDDKLISIGNVHAANHSKLQNIQMVVMKNEDRPLPVL 189

  Fly   406 ILRGVKQMHVTITP 419
            :||..:.:..::||
Yeast   190 LLREGQILKTSLTP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 39/209 (19%)
Trypsin_2 141..280 CDD:290102 13/50 (26%)
PDZ_serine_protease 323..417 CDD:238487 16/111 (14%)
NAS2NP_012259.3 Nas2_N 31..109 CDD:408080 18/100 (18%)
PDZ 106..182 CDD:395476 11/75 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.