DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and DEG5

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_567552.2 Gene:DEG5 / 827564 AraportID:AT4G18370 Length:323 Species:Arabidopsis thaliana


Alignment Length:361 Identity:99/361 - (27%)
Similarity:151/361 - (41%) Gaps:113/361 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALRGSHRLEVIFKR----------CIASPVLHSHAAN-RRSSQLAIKEGDPNSNGNSGQYQQNG 54
            :|..||:.::||.:|          .:.|.:|.|:... ...|.:|::           |:::..
plant    28 LACSGSNHVDVIDRRRRIMIFGSSLALTSSLLGSNQQRLPMESAIALE-----------QFKEKE 81

  Fly    55 EQKEKGWRRLVRFFVPFSLGAVVSAAIIQREDLTPTIAASKMTGRRRDFNFIADVVAGCADSVVY 119
            |:.|:...|.|..|                :..:|                          ||||
plant    82 EELEEEEERNVNLF----------------QKTSP--------------------------SVVY 104

  Fly   120 IEIKDTRHFDYFSGQPIT-------ASNGSGFIIEQNGLILTNAHVVINKPHTM-----VQVRLS 172
            ||..:.....  ||..:|       ...||||:.::.|.|:||.||:.......     .:|.|.
plant   105 IEAIELPKTS--SGDILTDEENGKIEGTGSGFVWDKLGHIVTNYHVIAKLATDQFGLQRCKVSLV 167

  Fly   173 D--GRTF--PATIEDVDQTSDLATLRIQV--NNLSVMRLGKSSTLRSGEWVVALGSPLALSNTVT 231
            |  |..|  ...|..:|..:|||.|:|:.  ..|:.:.||.|:.||.|:...|:|:|....||:|
plant   168 DAKGTRFSKEGKIVGLDPDNDLAVLKIETEGRELNPVVLGTSNDLRVGQSCFAIGNPYGYENTLT 232

  Fly   232 AGVISSTQRASQELGLRN-RDIN-YLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVT-------A 287
            .||:|...|   |:...| :.|: .:||||.|..|||||||::..|..||||:...|       :
plant   233 IGVVSGLGR---EIPSPNGKSISEAIQTDADINSGNSGGPLLDSYGHTIGVNTATFTRKGSGMSS 294

  Fly   288 GISFAIPID-------YVKVFLERAAEKRKKGSAYK 316
            |::||||||       |:.|:          |:||:
plant   295 GVNFAIPIDTVVRTVPYLIVY----------GTAYR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 83/284 (29%)
Trypsin_2 141..280 CDD:290102 56/151 (37%)
PDZ_serine_protease 323..417 CDD:238487
DEG5NP_567552.2 Trypsin_2 131..280 CDD:290102 56/151 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D630723at2759
OrthoFinder 1 1.000 - - FOG0000153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.