DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and DEG1

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001325789.1 Gene:DEG1 / 822416 AraportID:AT3G27925 Length:439 Species:Arabidopsis thaliana


Alignment Length:330 Identity:108/330 - (32%)
Similarity:164/330 - (49%) Gaps:52/330 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 SVVYIEIKDTRHFDYFSGQ--PITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFP 178
            |||||.....|. |.|:..  .:...:||||:.::.|.|:||.||:  :..:.::|.|:|..||.
plant   131 SVVYITNLAVRQ-DAFTLDVLEVPQGSGSGFVWDKQGHIVTNYHVI--RGASDLRVTLADQTTFD 192

  Fly   179 ATIEDVDQTSDLATLRIQV--NNLSVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQR- 240
            |.:...||..|:|.|||..  |.|..:.:|.|:.|..|:.|.|:|:|..|.:|:|.||||..:| 
plant   193 AKVVGFDQDKDVAVLRIDAPKNKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLTTGVISGLRRE 257

  Fly   241 -ASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNS-----MKVTAGISFAIPIDYVK 299
             :|...|...:|:  :||||||..|||||||::..|..||:|:     ...::|:.|:||:|.|.
plant   258 ISSAATGRPIQDV--IQTDAAINPGNSGGPLLDSSGTLIGINTAIYSPSGASSGVGFSIPVDTVG 320

  Fly   300 VFLERAAEKRKKGSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSNLTHGVLVWKVIVGS 364
            ..:::..         :.|...:..:||   ...||         |::......||||.......
plant   321 GIVDQLV---------RFGKVTRPILGI---KFAPD---------QSVEQLGVSGVLVLDAPPSG 364

  Fly   365 PAHSGGLQP-----------GDIVTHINKKEIKNSSDVYDALADNSKTLD---IVILRGVKQMHV 415
            ||...|||.           |||:|.:|..::.|.||:|..| |..|..|   :.:|||..:..:
plant   365 PAGKAGLQSTKRDGYGRLVLGDIITSVNGTKVSNGSDLYRIL-DQCKVGDEVTVEVLRGDHKEKI 428

  Fly   416 TITPE 420
            ::|.|
plant   429 SVTLE 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 108/330 (33%)
Trypsin_2 141..280 CDD:290102 59/142 (42%)
PDZ_serine_protease 323..417 CDD:238487 30/107 (28%)
DEG1NP_001325789.1 degP_htrA_DO 122..>438 CDD:273938 108/330 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D630723at2759
OrthoFinder 1 1.000 - - FOG0000153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100391
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X265
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.