DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and si:dkey-84o3.7

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_017208436.1 Gene:si:dkey-84o3.7 / 799634 ZFINID:ZDB-GENE-091113-30 Length:200 Species:Danio rerio


Alignment Length:206 Identity:104/206 - (50%)
Similarity:153/206 - (74%) Gaps:14/206 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 LGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK 284
            :|||.:|.||:|:|::||.||.|:||||.|.:::|:||||.|.||||||||:|||||.|.:|:||
Zfish     1 MGSPFSLKNTITSGIVSSAQRGSKELGLSNSNMDYIQTDATIDFGNSGGPLINLDGEVIDINTMK 65

  Fly   285 VTAGISFAIPIDYVKVFLERAAEKRKK---GSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQN 346
            ||||||||||.|.|::||:|:|:|:|.   .|.:|     :||:|:.||||||.|:.||:.|.  
Zfish    66 VTAGISFAIPSDRVRLFLDRSADKQKSWFGESGWK-----RRYIGVMMLTLTPSIIEELRMRD-- 123

  Fly   347 MPS--NLTHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKTLDIVILRG 409
             ||  ::.||||:.:|||||||:..|::|||::..||..::..|.::|:|:. .|::|::|:.||
Zfish   124 -PSFHDVFHGVLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSEEIYNAVR-TSESLNVVVRRG 186

  Fly   410 VKQMHVTITPE 420
            ...:.:.:|||
Zfish   187 ADLLMLHMTPE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 104/206 (50%)
Trypsin_2 141..280 CDD:290102 38/59 (64%)
PDZ_serine_protease 323..417 CDD:238487 40/95 (42%)
si:dkey-84o3.7XP_017208436.1 Trypsin_2 <1..59 CDD:290102 37/57 (65%)
PDZ_serine_protease 102..186 CDD:238487 38/87 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579594
Domainoid 1 1.000 47 1.000 Domainoid score I11974
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113300
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D238833at33208
OrthoFinder 1 1.000 - - FOG0000153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.