DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and si:dkey-112g5.16

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001103640.1 Gene:si:dkey-112g5.16 / 799537 ZFINID:ZDB-GENE-141219-11 Length:195 Species:Danio rerio


Alignment Length:204 Identity:102/204 - (50%)
Similarity:151/204 - (74%) Gaps:15/204 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 LGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK 284
            :|||.:|.||:|:|::||.||.|:||||.|.:::|:||||.|.||||||||:|||||.||:|:||
Zfish     1 MGSPFSLKNTITSGIVSSAQRGSKELGLSNSNMDYIQTDATIDFGNSGGPLINLDGEVIGINTMK 65

  Fly   285 VTAGISFAIPIDYVKVFLERAAEKRKK---GSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQN 346
            ||||||||||:     ||:|:|:|:|.   .|.:|     :||:|:.||||||.|:.||:.|..:
Zfish    66 VTAGISFAIPL-----FLDRSADKQKSWFGESGWK-----RRYIGVMMLTLTPSIIEELRMRDPS 120

  Fly   347 MPSNLTHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKTLDIVILRGVK 411
            .| :::||||:.:|||||||:..|::|||.:..||..::..|.::|:|:. .|::|::|:.||..
Zfish   121 FP-DVSHGVLIHRVIVGSPANRAGMKPGDNIIEINGVKVNTSEEIYNAVR-TSESLNVVVRRGAD 183

  Fly   412 QMHVTITPE 420
            .:.:.:|||
Zfish   184 LLMLHMTPE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 102/204 (50%)
Trypsin_2 141..280 CDD:290102 38/59 (64%)
PDZ_serine_protease 323..417 CDD:238487 39/93 (42%)
si:dkey-112g5.16NP_001103640.1 Trypsin_2 <1..61 CDD:290102 38/59 (64%)
PDZ_serine_protease 97..181 CDD:238487 37/85 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579596
Domainoid 1 1.000 176 1.000 Domainoid score I3556
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113300
Inparanoid 1 1.050 326 1.000 Inparanoid score I2456
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D238833at33208
OrthoFinder 1 1.000 - - FOG0000153
OrthoInspector 1 1.000 - - otm25664
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22939
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X265
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.