DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and si:dkey-19p15.4

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_021336616.1 Gene:si:dkey-19p15.4 / 797876 ZFINID:ZDB-GENE-081028-23 Length:260 Species:Danio rerio


Alignment Length:241 Identity:138/241 - (57%)
Similarity:189/241 - (78%) Gaps:12/241 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 FSGQPITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLRI 195
            |||:.:..||||||||..:.||:||||||.|||.  |:|:|::|.|:.||::||||.:|:||::|
Zfish    23 FSGREVPISNGSGFIISSDDLIVTNAHVVANKPG--VRVKLTNGETYNATVQDVDQAADIATIKI 85

  Fly   196 QVNN-LSVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDA 259
            .|.| |..:||||||.:|.||:|||:|||.:|.||:|:|::||.||.|:||||.|.:::|:||||
Zfish    86 NVKNPLPTLRLGKSSDVRQGEFVVAMGSPFSLKNTITSGIVSSAQRGSKELGLSNSNMDYIQTDA 150

  Fly   260 AITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAEKRKK---GSAYKTGYPV 321
            .|.||||||||:|||||.||:|:||||||||||||.|.|::||:|:|:|:..   .|.:|     
Zfish   151 TIDFGNSGGPLINLDGEVIGINTMKVTAGISFAIPSDRVRLFLDRSADKQNSWFGESGWK----- 210

  Fly   322 KRYMGITMLTLTPDILFELKSRSQNMPSNLTHGVLVWKVIVGSPAH 367
            :||:|:.||||||.|:.||:.|..:.| :::||||:.:|||||||:
Zfish   211 RRYIGVMMLTLTPSIIEELRMRDPSFP-DVSHGVLIHRVIVGSPAN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 138/241 (57%)
Trypsin_2 141..280 CDD:290102 85/139 (61%)
PDZ_serine_protease 323..417 CDD:238487 25/45 (56%)
si:dkey-19p15.4XP_021336616.1 DegQ 22..>256 CDD:333159 138/241 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9474
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113300
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D238833at33208
OrthoFinder 1 1.000 - - FOG0000153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.